KEGG   Thermogladius cellulolyticus: TCELL_0855Help
Entry
TCELL_0855        CDS       T02127                                 

Definition
hexokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
thg  Thermogladius cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCELL_0855
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_0855
   00052 Galactose metabolism
    TCELL_0855
   00500 Starch and sucrose metabolism
    TCELL_0855
   00520 Amino sugar and nucleotide sugar metabolism
    TCELL_0855
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TCELL_0855
   00524 Butirosin and neomycin biosynthesis
    TCELL_0855
Enzymes [BR:thg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TCELL_0855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(787937..788893)
Genome map
AA seq 318 aa AA seqDB search
MARRVHLAVDVGATWTRLAVAVDEVFVKKVVVRTPREGGRLAVAEEVARTFEKEFKEYRE
RVEAIGIGTIGPLDMRRGVVVNTPNLPLGTFELKKPLEDFFNRPVYVVNDAVAGVLAEKY
YGEGVGYNNLVYVTISTGVGGGVIVDGRVILGKDGNAHEIGHIVVKYDSDLRCGCGGYGH
WEAYAGGANIPRLAKYVAERNPSISKVSVIGERALNGSLEPREVFKAAKRGDPLGRLIVD
EIVKANAAGLASVINAYDPEFVSIGGSVFLYNTDLLYQPVVEIVKKNIVVRPPVIVPTKL
GDDVVLYGALALAVYRPV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaggagagtccacctagcagttgacgtaggggcgacatggactaggcttgctgtc
gctgttgacgaagtttttgtcaaaaaggtagtagtcaggaccccccgcgagggcggcagg
ctggcagtcgcggaggaggtcgcccggacgttcgaaaaggagttcaaggagtaccgcgag
agggttgaggcaataggcatcggcaccatcggcccactagacatgaggcggggcgttgtc
gtgaacaccccaaacctccccctggggacgttcgagcttaagaagccgctcgaagacttc
tttaataggccggtctatgtagtgaacgacgcagtggctggtgtcctggccgaaaagtac
tacggagagggcgtgggctacaacaacctcgtctacgtcaccatcagcactggtgtgggg
ggaggggtcatagtggacggccgcgtcatactagggaaggacggtaacgcccacgagatc
gggcacatagtagtaaaatacgactcggacctcaggtgcggctgcggcggctacggccac
tgggaggcgtatgctggaggggccaacatacccagactcgcaaagtacgttgccgagaga
aacccctcgatctcaaaggtatctgtcataggcgagagggccttaaacgggtcgctagag
ccgcgtgaggtcttcaaggcggccaagagaggtgaccctctgggccggctgatcgtcgac
gagatagtcaaggcgaacgctgcgggcctcgccagcgtgataaacgcttacgacccggag
ttcgtatcgatcggggggagcgtattcctgtacaacaccgaccttctctaccagcccgtc
gttgagatcgttaaaaagaacattgtggtgagacctcctgtcatagtccccacgaagttg
ggagacgacgtagtactgtacggcgccttagcactcgctgtctacaggcccgtctag

DBGET integrated database retrieval system