KEGG   Thermogladius cellulolyticus 1633: TCELL_0872Help
Entry
TCELL_0872        CDS       T02127                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
thg  Thermogladius cellulolyticus 1633
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:thg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:thg00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(803152..804429)
Genome map
AA seq 425 aa AA seqDB search
MSVMFVTHLKCSKCGRVYKLEEKPVTCVNKDLGRLDVYYDYEAIASSVSREELAKRPFYM
WRYKEFLPVPSEEYIVTLGEGGTPLLKAKRLGERLGLKNLYLKDETRNPTGSFKDRAMSV
SVSMAKYFGFKRAVIASSGNAAASLAAYGAKAGIEVYAFVPDFAGFGKIAQLLYYGAKVF
KVKWTEAEDPTVKMMRVLSERYGFYPSPSFGVFNPYQIEGPKTISMEIVEQLGWRLPDQV
FVPTGAASLLTGVFNGFRDWNQVGWITGYPRLVAVQPEGNYPFVRAWMERADPNKIRPWE
KPPETIATGLEDTFPWDGDAGLRALYKTNGYGVVVKDDEIVEAMKLLASLEGVFAEPSGA
AGLAGLIKAIEDRQVDKDETVVVLVTGHGLKDPDIVKKTAGDVPLINPAEEEFFAAARKY
YGSEF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcatgttcgttacacacttgaagtgtagtaagtgtgggagggtgtacaagcta
gaggagaagcctgtcacgtgcgtcaacaaggacttggggaggctcgatgtctactacgac
tacgaggcgatcgcctcaagtgtaagcagggaggagctggccaagaggcctttctacatg
tggaggtacaaggagttcctgccggtccccagcgaggagtacattgtcacgctcggggag
ggcgggacaccgctactaaaggctaagaggctcggcgagaggctcggcctgaagaacctc
tacttgaaggacgagaccaggaaccccaccggtagcttcaaggacagagcaatgagcgtc
tcggtctcgatggcaaagtacttcgggttcaagagagcggttattgcgagtagcggtaac
gccgctgcttcactggccgcctacggcgctaaggcgggcatcgaagtatacgcattcgtg
cccgacttcgccggcttcggcaagatagcccagctcctgtactacggggccaaggtcttc
aaggtaaagtggactgaggcagaggaccccaccgttaaaatgatgagagtactcagcgag
aggtacggcttctatcccagccccagcttcggggtcttcaacccctaccagatagaaggc
ccgaagaccatctccatggagatcgtcgagcagttgggctggagactaccagaccaggta
ttcgttcccacaggtgccgcaagcctcctcacaggcgtcttcaacggcttcagggactgg
aaccaggtcggctggataaccgggtacccgaggctagtggctgttcagccggagggcaac
tacccgttcgttagggcgtggatggagagggccgaccccaacaagataaggccgtgggag
aagccgccagagacgattgctacagggttagaagacacattcccgtgggatggagacgcc
ggcctcagagccctttacaagactaacggttacggtgtcgttgtgaaagacgacgagatc
gtagaggcgatgaagctgcttgccagccttgaaggggtcttcgccgagcccagtggagcg
gcggggttagcaggcctgatcaaggcgattgaggacaggcaggtcgacaaggacgagaca
gtagtcgtgttagtgaccggacacggcctgaaagaccccgacatagtcaagaaaacagca
ggcgacgtacccttaatcaaccccgccgaagaagagttcttcgcagccgcaagaaagtac
tacgggtcggagttctga

DBGET integrated database retrieval system