KEGG   Thermogladius cellulolyticus: TCELL_0959Help
Entry
TCELL_0959        CDS       T02127                                 

Definition
glyceraldehyde-3-phosphate:ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
thg  Thermogladius cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCELL_0959
   01230 Biosynthesis of amino acids
    TCELL_0959
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_0959
Enzymes [BR:thg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     TCELL_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(898107..900059)
Genome map
AA seq 650 aa AA seqDB search
MSLKYRVVFVNPGEKTSRLAEYDLSEVRGPVSLGVKLHSEVYESWKKPVYHPDNALVIGT
GLVAGSKLYGVHRLVAVFRSPLTRGLHVAAMGGAAYQLAARLHSIVVDGAAGRPTIVLLR
GHKDGAVEVSFSELEDSELESVWRGYRGLKGTYALTKYVVDKHPDFFKGGLSRVVAVGPA
SKYTSLGALFSATLFNGEIDYGSEDLAARGGPGSVLLRAHNVAAIAYSGSYDRSADLPRE
MTELRAISDYTVKKLGKPYINAVIEAGTKYRFDPKLNTGGTFGSNYPHLRTQTPMFNWNM
IYLPNDVREKLFNYIMKYYWEPFNKEAIESKSWKTCGEPCPVACKKVRKGKYKTDYEPYN
GLGPMIGVFDLHEAERLVELADAYGFDAIELGNLIAFVFEALENGLLRPEEVSLSRKPSF
NPLNYTVEHSKTNADLAEDVIESMAWGTNPILRLIADRGLRSAAKVLDLLYEERTKERKT
RFVDLAVYASFGEEGHITPNFYWTPGMVAPLPVLGRYWTLYTGVFLDPEEFAAKSYERAV
MELMIDDSGVCRFHRGWAEKLLPSLYADYYGLKDTLQFYKRLYKRLAEYQSHTAEPTLWE
SRKVFDYMTKAAAEYANKTWTEKFSVEGEKSVVEWWARFKKKLAELVSSA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgaagtacagggttgttttcgtcaacccaggcgaaaagacgtctaggctggca
gagtacgacctgagcgaggtcagggggccggtaagcctcggcgtaaagctacacagcgaa
gtctacgagtcgtggaagaagccggtctaccaccccgacaacgccctcgtgatcggcact
ggactagttgcggggagcaagctctacggagtccacaggctggtcgctgtattcaggagc
ccgctgacccgcggactccacgtggccgcgatgggcggggcggcctaccaactagccgca
agactccacagcatagtggtagatggggcggccggcaggcccacaatagtactcctgagg
ggccacaaggatggtgctgtagaggtctccttcagcgaattggaggatagcgagctggag
agcgtgtggaggggctacagggggctcaagggcacctacgccctgacgaagtacgtggtc
gacaagcaccccgacttcttcaaggggggcctcagtagggttgtggccgtcggccccgcg
tccaagtacacgagcctgggcgcgctcttctcggcgacgctcttcaatggcgagatagac
tacgggagcgaggacctcgcagcgagaggcgggccaggtagcgtcttgttgagggcgcac
aacgtagccgctattgcgtacagcggtagctacgacaggtcggcagacctgcccagagag
atgaccgagctcagggcgatcagcgactacactgttaagaagctggggaagccgtacata
aatgcggtgatcgaggcggggaccaagtacaggttcgaccccaaactgaacaccgggggc
accttcggctccaactacccccacctaaggacgcagacgccgatgttcaactggaacatg
atctacctccccaacgatgtgcgcgagaagctcttcaactacataatgaagtactactgg
gagccctttaacaaggaggctatcgagtcgaagagctggaagacgtgcggcgagccgtgc
cccgtcgcgtgcaagaaggtgaggaaggggaagtacaagaccgactacgagccctacaac
ggcctcgggcccatgataggcgttttcgacctccacgaggccgagagactcgtcgagcta
gccgacgcctacggcttcgacgcaatagagctcggcaacctgatcgcgttcgtgttcgaa
gccttggagaacgggttgctcagacccgaggaggtctcgctaagcagaaagccgtccttc
aacccgctcaactacacggtggaacacagcaagaccaacgccgacctcgcagaggatgtc
atcgagtcgatggcctggggcacaaaccccatactgaggctcatcgccgatagaggtctc
aggtcggccgccaaagtgctggacctcctctacgaggaaaggactaaggagagaaagact
agattcgtagacctcgcggtctacgcctcgttcggcgaggaagggcacataaccccgaac
ttctactggacgcccggcatggtggcccctctaccagtccttgggaggtactggacgctc
tacacaggcgtcttcctagacccggaggagttcgcggccaagagctacgagagggctgta
atggagctgatgatagacgactccggggtctgcaggttccacaggggctgggcagagaag
ctactaccctcgctgtatgccgactactacggtctgaaagacaccctccagttctacaag
aggctatacaagaggctcgccgagtaccagtcacacaccgccgagcccaccttgtgggag
agcaggaaggtgttcgactacatgaccaaggcagccgccgagtacgctaacaagacgtgg
acggagaagttctctgtcgagggagagaagtcggtcgtggagtggtgggccaggttcaag
aagaagctagccgagctcgtatcctcggcctag

DBGET integrated database retrieval system