KEGG   Thermogladius cellulolyticus: TCELL_1003Help
Entry
TCELL_1003        CDS       T02127                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
thg  Thermogladius cellulolyticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TCELL_1003
Enzymes [BR:thg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TCELL_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
933671..934615
Genome map
AA seq 314 aa AA seqDB search
MITVLGSIHVDFVIRVKRFPHPGETILGHGFTILPGGKGANQAVGCGRLGVKTFMVGKIG
RSFRDMLVDNFKSNNVDTSYITFTDEYETGVAVIYVNDETGENMIAVDPGADYALSRGDV
DRAEPALSSSRVFLTQLEIPIELVEYSLAKAAEYVDYVVLNPAPASSLRGEVLRHVDVIT
PNRSEASLLTGVKVTDVKSAVEAGRRLIEMGVEHVVVTMGSEGAVLVARDHALLFPAFRV
SVVDTTGAGDAFNAGLAYGLAAGLPLPESVKIGVAAAAIKVTKPGAQTGLPWRADLDVFA
QRREFQEYEPVVVA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgataacagtcctcggaagtatacacgtggacttcgtaattagagttaagaggttcccg
caccccggcgagacgatcctgggacacggcttcacgatactccccgggggtaaaggcgct
aaccaggccgtgggctgcgggaggctgggagtaaagaccttcatggtgggtaagatcggt
aggagcttccgggacatgctcgttgacaacttcaagtcgaacaacgtcgacacctcctac
ataacgttcacggacgagtacgagaccggtgtagccgtcatctacgtcaacgacgagaca
ggcgagaacatgatagccgtcgaccctggggcggactacgcgttgtcgagaggggacgta
gatagagctgagccagccctctcctcctccagggtgttcctcacccagttggaaataccc
atcgagctagtcgagtactcgctcgcgaaggcggccgagtacgtcgactacgtagtgcta
aaccccgcgcccgcgagcagtttgcgtggagaggtcttgaggcacgtagacgtcatcacg
ccaaacaggtcggaggcctcgctcctcacgggtgtgaaggtcaccgacgtcaagagcgcg
gtggaggcgggtcggaggctaattgaaatgggtgtagaacacgtggtcgttacaatgggg
tctgagggagcggtcctagtcgcgagagaccacgcactgttgttcccggccttccgggtg
agcgtggtagacacgactggagcgggggacgcgttcaacgccggcctggcgtacgggctg
gccgcaggcctccccctcccggagtccgtgaaaataggcgtcgcggcagcggctataaag
gtgacgaagccgggcgcccagacggggctcccgtggagggccgacctagacgtcttcgcc
cagaggagggagttccaggagtacgagccggtcgtggtggcctag

DBGET integrated database retrieval system