KEGG   Thermogladius cellulolyticus: TCELL_1098Help
Entry
TCELL_1098        CDS       T02127                                 

Definition
glycoside hydrolase family protein
Orthology
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
thg  Thermogladius cellulolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TCELL_1098
Enzymes [BR:thg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TCELL_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1032743..1034284)
Genome map
AA seq 513 aa AA seqDB search
MPDVVFVFEVHQPYRLARNVYQRLVERALKGELTLRDVEEALFDQPLNKLVMERAAAKCY
IPATQIVLENINRYKDWDRKFKVTYSVSGVFVEQARRWAPQVIELFRKLAETGLVEFASQ
TYYHSMVAFLGVPEYKELVEQVTEHRRLMEETVGYRPTSIENTEFSYNNDIAAVFAGLGY
KVVLTEGVDRVLGWRSPNYVYKAYGSEIRVLTRNYRLSDDVGFRFSDRNWDQYPLTADKY
SAWLAATPGDVIMIAVDYETFGEHHWPETGIHEFLRWLPGEVLKYTNLSFSTPSEVVDKY
PARDVFDVPPWSSISWADERDLSAWLGNSMQQASMKALYDLYYYVVALDEPGLRRLWKLL
TISDHLYYQATKFGSIGEVHAYFSPYKNAPDAYALFMEAVGVLSMLVASSIARNPRGFAR
RFKTPPEKAFYFYSPLEGFIGLKASSLLELADQVRGVPDDIVLFHARRGDFSSWVRNVFM
LGDLADRISEAEKREPREAKELIARHINEYLGV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgttgttttcgtgttcgaggtccaccagccctaccgtctcgctaggaacgtc
taccagaggcttgtcgagagggccctcaaaggcgagctcacgctgagagacgtggaggag
gctctcttcgaccagcccctgaacaaactcgtgatggagagggcggctgccaagtgttat
atacccgctactcagatcgtactggagaacatcaaccgctacaaggactgggacaggaag
ttcaaggtcacttactcggtttcgggggtcttcgtagagcaggctaggcggtgggctccg
caagtgatcgagctcttcaggaagctggcggagacaggcctggtggagttcgcgagccag
acctactaccacagcatggtcgcctttctcggcgtccccgagtacaaagagctcgtcgag
caggtcacagagcacaggaggctaatggaggagaccgtcggctacaggcctactagcatc
gagaacacggagttctcgtacaacaacgacatagccgccgtcttcgccgggctgggctac
aaggtcgtgttgacggagggcgtcgacagggtactgggctggaggtccccgaactacgtc
tacaaggcgtacggtagcgagataagggtgttgacgaggaactacaggctgagcgacgac
gtagggttcaggttcagcgacaggaactgggaccagtacccgttgacggctgacaagtac
tcggcttggctggctgccacccccggcgacgtgattatgatagccgtggactacgagacc
ttcggcgagcaccactggcctgagaccggcatacacgagttcctccgctggctccccggc
gaggtcctgaagtacacgaacctctcgttctctacgccgagcgaggtggtagacaagtac
ccggctagggacgtattcgacgtcccgccttggtcctcgataagctgggcggacgagcgg
gacctgagcgcctggctggggaacagcatgcagcaggcctctatgaaggcgctctacgac
ctctactactacgtggtggcgcttgacgagccggggttgaggaggctgtggaagctcctc
acgataagcgaccacctgtactaccaagccacgaagttcggtagcataggcgaggtccac
gcatacttctcgccctacaagaacgccccggacgcctacgccctgttcatggaggctgtg
ggggtcctgtctatgcttgtggccagctcgatagccaggaacccgagggggttcgcgagg
aggttcaagacgccgcccgagaaggccttctacttctactcacctctcgagggcttcatc
ggcctcaaggcctcgagcctactggagctcgccgaccaggtgaggggcgtgccggacgac
atagtcctcttccacgcgaggaggggcgacttctcgagctgggtgagaaacgtctttatg
ctcggcgacctagcagacaggatcagtgaggccgagaagagagagccccgcgaggccaag
gagctgatcgcgaggcatataaacgagtacctgggtgtatag

DBGET integrated database retrieval system