KEGG   Thermogladius cellulolyticus: TCELL_1236Help
Entry
TCELL_1236        CDS       T02127                                 

Definition
pyruvate ferredoxinoxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
thg  Thermogladius cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCELL_1236
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_1236
   00020 Citrate cycle (TCA cycle)
    TCELL_1236
   00620 Pyruvate metabolism
    TCELL_1236
   00640 Propanoate metabolism
    TCELL_1236
   00650 Butanoate metabolism
    TCELL_1236
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TCELL_1236
   00680 Methane metabolism
    TCELL_1236
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TCELL_1236
Enzymes [BR:thg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TCELL_1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1176973..1178241
Genome map
AA seq 422 aa AA seqDB search
MVAVTQAVVKPRVPLEKQVMMTVNGDEAVAYAVKQSLVDVVAAYPITPQTIIVEKFSEFV
ADGEVKTEFVPVESEHSAMSACVGAAAAGARAFTATSSQGLALMVEILYIASALRLPIVM
AVVNRALSAPINIHNDHSDAYLMRDSGWIQLFAENVQEAYDTTIQAFKIAEDERVLLPVA
VNLDGFFLSHTLENIYMLPDEVVHEFLGGYRKVSKVKVDYFDEEVPLALNPARPLSFGNL
DLYDYYFEHKVQQVEAMKSVPEVVREVNEEWFKLTGRRYGDGILDPFEVEDADVVLVGMG
SGVGTMRSVVRRLRKEGLKVGLVKLRMFRPFPFKEVVEVLKNAKVVAVMEKGVSPGSYGP
LFLEVNTALYDLKSRPALVNYVYGLGGRDLVPDLVEGMIRGLFKELEKGVFEPKLRYLGV
RE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggtagccgtgacccaggccgtggttaaaccccgagtacccttggagaagcaagtcatg
atgaccgtgaacggcgacgaggcagtggcgtacgccgtcaagcagagcctagtcgacgtc
gtcgccgcgtacccgatcacaccccagacgatcatagtcgagaagttctcggagttcgtt
gcagacggcgaggtgaagaccgagttcgtccccgtagagtcggagcactccgccatgagc
gcctgcgtcggggccgcggccgcgggcgccagggccttcacagcgacctcctcgcagggg
ctcgccctcatggtggagatactgtacatcgcgtccgccctgaggctacccatagtcatg
gcggtagtcaacagggccctctcggccccgatcaacatacacaacgaccacagcgacgcg
tacctcatgagggactcgggctggatacagctcttcgccgagaacgtacaggaggcctac
gacaccactatccaggccttcaagatagccgaggacgagcgggtgctcttgcccgtggcc
gttaacctggacggcttcttcctcagccacacgctcgagaacatctacatgctccccgac
gaggtcgtccacgagttcctcggcggctacaggaaggtgagcaaggtgaaggtcgactac
ttcgacgaggaggtacccctcgcactcaaccccgctaggcccctgagcttcggcaacctg
gacttgtacgactactacttcgagcacaaggtccagcaggtggaggcgatgaagagcgtc
cccgaggtcgtacgcgaggtcaacgaggagtggttcaagctgactgggaggaggtacggc
gacggcatactagacccgttcgaggtggaggacgccgacgtagtcctagtgggtatgggt
agcggcgtcgggaccatgaggagcgtagtgaggaggctgaggaaggagggcctcaaggtg
gggctggtgaagctcaggatgttcaggccgttcccgttcaaggaggtcgttgaggtgttg
aagaacgcaaaagtcgtagcggtaatggagaagggggtgagcccgggtagctacggcccg
ctattcctcgaggtcaacacagccctgtacgacctgaagagcaggccagcgctggtcaac
tacgtctacgggctaggcggtagagacctcgtcccggacctcgtcgaggggatgataagg
gggctgtttaaggagctcgagaagggggtattcgagcccaagctcaggtacctcggcgtg
agggagtga

DBGET integrated database retrieval system