KEGG   Thermogladius cellulolyticus: TCELL_1247Help
Entry
TCELL_1247        CDS       T02127                                 

Definition
(RefSeq) AMP phosphorylase / thymidine phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
thg  Thermogladius cellulolyticus
Brite
Enzymes [BR:thg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     TCELL_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1187853..1189382)
Genome map
AA seq 509 aa AA seqDB search
MLVSKEARNFTVSVLEVSTGSPLLVMNEQDAFEMSLTPHSKVMVKYEGREAYASVTLTKT
MVAKGRVLASIELAEKLGLKEGYPVQVKPAGLPGSYASLLKRIRGERLSYNEMYSIIKDV
VNGAYDEAEIAAFLLSQQFYVLDEDELTSLIKAMVETGVKISFDEPVFDEHSIGGVPGNS
KVAMVAVPIVASFGLLIPKTSSRAITSPAGTADTMEVLARVDLTAEEIRELAKKTRGLLV
WGGKLNLAPADDIFVNVERKLSIDPWHQMVASILSKKLAMSVESLVIDIPVGKKAKIEEP
VHADQLAGLFIRQAAKLGMRVKVAITFGGQPIGMSVGPALEAKEALEALLNKRGSRSLVD
KAILIAGLTMELSGKVPPGQGESYARELFSSGKAYEKFREIIEAQGGKPNIKPEEVPLGK
YTYTFKSPLEGAVTYIDNAAVTMVARAAGAPFDKGAGVQFHAKVGYRVNKGDPLFTIYSN
SESRLEEAISLASKYSVITVEGMLLKTLP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtatccaaggaggccaggaattttactgtgagcgtcttagaggtttccacgggg
agtcctcttctagtcatgaacgagcaagacgcgttcgagatgagtttaacaccccactcc
aaggtcatggtcaagtacgagggcagagaggcctacgcctcggtcacgctgaccaagacc
atggtagcgaaggggagggttctcgcgtccattgaattggccgagaagctcggcctgaaa
gagggctatccagtccaggtcaagcccgcaggcctccccgggtcgtacgcttccctgctc
aagaggattcggggagagcgcctgagctacaacgagatgtactcgataataaaggacgtc
gtgaacggggcctacgacgaggccgagatagccgctttcttgctcagccaacagttttac
gtcctagacgaggacgagctcactagcctgataaaggccatggtcgagacaggagtgaaa
ataagcttcgacgagcccgttttcgacgagcacagtatcggcggtgtcccggggaacagc
aaggtcgcgatggtggcggtacccatagtcgcgtcgttcggcctactcatcccgaagact
agtagcagggctataaccagcccggccggtacggccgacacgatggaggtcctagcaaga
gtagacttgacagcggaagagattagagagctcgctaagaagacgagagggctcctggtc
tggggcgggaagctcaacctagccccagcagacgacatcttcgtgaacgtggagaggaag
ctttccatagacccgtggcaccagatggtcgcgagtatactgagtaagaagctcgccatg
agcgtcgagtccctagttatagacattcccgtcgggaagaaggcgaagatagaggagccg
gttcacgcagaccagttggccggcctcttcataaggcaggccgcaaagctaggcatgagg
gtcaaggtagccataacattcgggggccagccgatcggcatgagcgtggggcccgccctc
gaggccaaggaggcactagaggccctgttgaacaagagggggtcgaggagcctcgtcgac
aaggctatcctgatagccggcttgaccatggagttgagcgggaaggtgccgcctggtcag
ggcgagagctacgctagggagttgttctcctcgggcaaggcctacgagaagttcagggag
ataatcgaggcccagggcggcaaaccgaacattaaaccagaggaggtcccgctgggtaag
tacacttacacgttcaagtcgcctctagagggggcggtgacgtacatcgacaacgcggcg
gtaaccatggtggctagagcggcgggggccccgttcgacaagggcgccggggtacagttc
cacgcgaaggtgggctacagggtcaacaagggcgaccccctgttcaccatatacagtaac
agcgagagcaggctcgaggaggccatctcgctggcgtcgaagtactccgttataaccgtg
gagggcatgttgctgaagactctcccgtga

DBGET integrated database retrieval system