KEGG   Thermogladius cellulolyticus: TCELL_1249Help
Entry
TCELL_1249        CDS       T02127                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
thg  Thermogladius cellulolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TCELL_1249
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TCELL_1249
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TCELL_1249
Enzymes [BR:thg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TCELL_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1189986..1191299
Genome map
AA seq 437 aa AA seqDB search
MELRSSQRPDLLPKSWYNIVPDLPEKIPPYILPDGTVVKPEMFHALFARELVRQEFSDER
FIKIPDELSEYYLQAGRPTPLLRARNLEKYLDTCARIYFKYEGVLPAGSHKFNTAIAQAF
YNKLEGVKRLSTETGAGQWGSALSLAGSLVGIKVRVFMVRASYNQKPFRRILMETYGAEV
YPSPSTITSFGRKLLQENPDHPGSLGIAISEAIEDVINSGGEAKYSLGSVLNHVLLHQTV
IGQEAIKQLEELGVGVEDVSYVVGAVGGGSNYAGLAYPFLYYRLRGKTSTVFVAVEPRAV
PSMTRGEYRYDFGDTAGLTPMLKMHTLGHDFVPPPIHAGGLRYHGVAPSLSILVNHKLVE
PVAYGQREVFEAGVLFARLQGIVPAPESAHAVKAVIDIARRYRGSCERPVIVFNLSGHGL
LDLKGYEEYLYNALPDT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggagttaaggtcttcccaaagacccgacctcctacccaagtcctggtacaacatagtc
ccagacctcccggagaagatacctccctacatcctgccagacggaaccgttgtgaaaccc
gagatgttccacgccctgttcgccagggaactcgtcaggcaggagttcagcgacgagagg
ttcattaaaatacccgacgagctctccgagtactaccttcaggccgggaggcccacgccg
ctgctgagagcgagaaacctcgagaagtacctcgacacctgcgcgaggatatacttcaag
tacgagggagtcctgccggcgggctcccacaagttcaacaccgcgatagcccaggcgttc
tacaacaagctcgagggcgtcaagaggctcagtacagagactggcgccggccagtggggt
agcgccctatctctagccggtagcctagtgggcatcaaggtaagggtcttcatggtgagg
gcgagctacaaccagaagcccttcaggaggatactgatggagacctacggggccgaggtc
taccccagcccctccactataacctctttcggcaggaagctactccaggagaacccggac
cacccgggcagcctcggcatcgcgatatcggaggccatagaggacgtcatcaacagcggg
ggagaggccaagtacagcctcgggagcgtcctcaaccacgtcctcctacaccagaccgtg
atagggcaggaggcgatcaagcagttggaggagttgggtgtcggagtcgaggacgtatca
tacgtcgtgggggctgtcggcggcgggagcaactacgccggcctggcgtaccccttcctc
tactacaggcttagagggaagacgagcaccgtcttcgtggctgtagagcccagagcagtg
ccgtcaatgaccagaggggagtacaggtacgacttcggggacactgccgggctgacgccg
atgctgaagatgcacacgctcgggcacgacttcgtcccgccccccatacacgccgggggc
ctcaggtaccacggggtggcgccgtcgctaagcatactcgtaaaccacaagctggtggag
cccgtggcgtacgggcagagggaggtgttcgaggccggcgtcctgttcgcgaggttgcag
gggatagtgcccgccccggagagcgcccacgccgtgaaggccgtgatagacatagcgagg
aggtacagaggatcctgcgagaggcccgtcatagtcttcaacctcagcgggcacgggcta
ctcgacctaaagggttacgaggagtacctctacaacgccctaccggacacgtaa

DBGET integrated database retrieval system