KEGG   Thermogladius cellulolyticus 1633: TCELL_1249Help
Entry
TCELL_1249        CDS       T02127                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
thg  Thermogladius cellulolyticus 1633
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:thg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:thg00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:thg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1189986..1191299
Genome map
AA seq 437 aa AA seqDB search
MELRSSQRPDLLPKSWYNIVPDLPEKIPPYILPDGTVVKPEMFHALFARELVRQEFSDER
FIKIPDELSEYYLQAGRPTPLLRARNLEKYLDTCARIYFKYEGVLPAGSHKFNTAIAQAF
YNKLEGVKRLSTETGAGQWGSALSLAGSLVGIKVRVFMVRASYNQKPFRRILMETYGAEV
YPSPSTITSFGRKLLQENPDHPGSLGIAISEAIEDVINSGGEAKYSLGSVLNHVLLHQTV
IGQEAIKQLEELGVGVEDVSYVVGAVGGGSNYAGLAYPFLYYRLRGKTSTVFVAVEPRAV
PSMTRGEYRYDFGDTAGLTPMLKMHTLGHDFVPPPIHAGGLRYHGVAPSLSILVNHKLVE
PVAYGQREVFEAGVLFARLQGIVPAPESAHAVKAVIDIARRYRGSCERPVIVFNLSGHGL
LDLKGYEEYLYNALPDT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggagttaaggtcttcccaaagacccgacctcctacccaagtcctggtacaacatagtc
ccagacctcccggagaagatacctccctacatcctgccagacggaaccgttgtgaaaccc
gagatgttccacgccctgttcgccagggaactcgtcaggcaggagttcagcgacgagagg
ttcattaaaatacccgacgagctctccgagtactaccttcaggccgggaggcccacgccg
ctgctgagagcgagaaacctcgagaagtacctcgacacctgcgcgaggatatacttcaag
tacgagggagtcctgccggcgggctcccacaagttcaacaccgcgatagcccaggcgttc
tacaacaagctcgagggcgtcaagaggctcagtacagagactggcgccggccagtggggt
agcgccctatctctagccggtagcctagtgggcatcaaggtaagggtcttcatggtgagg
gcgagctacaaccagaagcccttcaggaggatactgatggagacctacggggccgaggtc
taccccagcccctccactataacctctttcggcaggaagctactccaggagaacccggac
cacccgggcagcctcggcatcgcgatatcggaggccatagaggacgtcatcaacagcggg
ggagaggccaagtacagcctcgggagcgtcctcaaccacgtcctcctacaccagaccgtg
atagggcaggaggcgatcaagcagttggaggagttgggtgtcggagtcgaggacgtatca
tacgtcgtgggggctgtcggcggcgggagcaactacgccggcctggcgtaccccttcctc
tactacaggcttagagggaagacgagcaccgtcttcgtggctgtagagcccagagcagtg
ccgtcaatgaccagaggggagtacaggtacgacttcggggacactgccgggctgacgccg
atgctgaagatgcacacgctcgggcacgacttcgtcccgccccccatacacgccgggggc
ctcaggtaccacggggtggcgccgtcgctaagcatactcgtaaaccacaagctggtggag
cccgtggcgtacgggcagagggaggtgttcgaggccggcgtcctgttcgcgaggttgcag
gggatagtgcccgccccggagagcgcccacgccgtgaaggccgtgatagacatagcgagg
aggtacagaggatcctgcgagaggcccgtcatagtcttcaacctcagcgggcacgggcta
ctcgacctaaagggttacgaggagtacctctacaacgccctaccggacacgtaa

DBGET integrated database retrieval system