KEGG   Thermogladius cellulolyticus: TCELL_1249Help
Entry
TCELL_1249        CDS       T02127                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
thg  Thermogladius cellulolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TCELL_1249
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TCELL_1249
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TCELL_1249
Enzymes [BR:thg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TCELL_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1189986..1191299
Genome map
AA seq 437 aa AA seqDB search
MELRSSQRPDLLPKSWYNIVPDLPEKIPPYILPDGTVVKPEMFHALFARELVRQEFSDER
FIKIPDELSEYYLQAGRPTPLLRARNLEKYLDTCARIYFKYEGVLPAGSHKFNTAIAQAF
YNKLEGVKRLSTETGAGQWGSALSLAGSLVGIKVRVFMVRASYNQKPFRRILMETYGAEV
YPSPSTITSFGRKLLQENPDHPGSLGIAISEAIEDVINSGGEAKYSLGSVLNHVLLHQTV
IGQEAIKQLEELGVGVEDVSYVVGAVGGGSNYAGLAYPFLYYRLRGKTSTVFVAVEPRAV
PSMTRGEYRYDFGDTAGLTPMLKMHTLGHDFVPPPIHAGGLRYHGVAPSLSILVNHKLVE
PVAYGQREVFEAGVLFARLQGIVPAPESAHAVKAVIDIARRYRGSCERPVIVFNLSGHGL
LDLKGYEEYLYNALPDT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggagttaaggtcttcccaaagacccgacctcctacccaagtcctggtacaacatagtc
ccagacctcccggagaagatacctccctacatcctgccagacggaaccgttgtgaaaccc
gagatgttccacgccctgttcgccagggaactcgtcaggcaggagttcagcgacgagagg
ttcattaaaatacccgacgagctctccgagtactaccttcaggccgggaggcccacgccg
ctgctgagagcgagaaacctcgagaagtacctcgacacctgcgcgaggatatacttcaag
tacgagggagtcctgccggcgggctcccacaagttcaacaccgcgatagcccaggcgttc
tacaacaagctcgagggcgtcaagaggctcagtacagagactggcgccggccagtggggt
agcgccctatctctagccggtagcctagtgggcatcaaggtaagggtcttcatggtgagg
gcgagctacaaccagaagcccttcaggaggatactgatggagacctacggggccgaggtc
taccccagcccctccactataacctctttcggcaggaagctactccaggagaacccggac
cacccgggcagcctcggcatcgcgatatcggaggccatagaggacgtcatcaacagcggg
ggagaggccaagtacagcctcgggagcgtcctcaaccacgtcctcctacaccagaccgtg
atagggcaggaggcgatcaagcagttggaggagttgggtgtcggagtcgaggacgtatca
tacgtcgtgggggctgtcggcggcgggagcaactacgccggcctggcgtaccccttcctc
tactacaggcttagagggaagacgagcaccgtcttcgtggctgtagagcccagagcagtg
ccgtcaatgaccagaggggagtacaggtacgacttcggggacactgccgggctgacgccg
atgctgaagatgcacacgctcgggcacgacttcgtcccgccccccatacacgccgggggc
ctcaggtaccacggggtggcgccgtcgctaagcatactcgtaaaccacaagctggtggag
cccgtggcgtacgggcagagggaggtgttcgaggccggcgtcctgttcgcgaggttgcag
gggatagtgcccgccccggagagcgcccacgccgtgaaggccgtgatagacatagcgagg
aggtacagaggatcctgcgagaggcccgtcatagtcttcaacctcagcgggcacgggcta
ctcgacctaaagggttacgaggagtacctctacaacgccctaccggacacgtaa

DBGET integrated database retrieval system