KEGG   Thermogladius calderae: TCELL_1375Help
Entry
TCELL_1375        CDS       T02127                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
thg  Thermogladius calderae
Pathway
thg00010  Glycolysis / Gluconeogenesis
thg01100  Metabolic pathways
thg01110  Biosynthesis of secondary metabolites
thg01120  Microbial metabolism in diverse environments
thg01130  Biosynthesis of antibiotics
thg01200  Carbon metabolism
thg01230  Biosynthesis of amino acids
Module
thg_M00002  Glycolysis, core module involving three-carbon compounds
thg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_1375
Enzymes [BR:thg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     TCELL_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AFK51797
UniProt: I3TGA9
Position
1308356..1309378
Genome map
AA seq 340 aa AA seqDB search
MKAPVAVNGYGTIGKRVAEAIRQMPDLELKGIVKYTPDYSVLVAYRQGIPIYVPKGKEGV
FEEVGVKPSGTVDELFGSVSLVVDASPGGKGAQNKRVYVERGLSALFEGGESPDVAEVSF
STLCNYRQALGKKYIRVVSCNTTALLRLICLLDRHIGVRKARAVIVRRASDPKEDKGIVN
TVKLDPPSIPSHHAIDVKTVLPDLDIETVALIVPTTLMHVHVVHIQTKRSTSIDEVVETL
SSTPRIVVLEGAKIGIDSTSKIVEFARDLGRKRYDIYENVVWRDMIKVNGDELTIVQAVH
QEAIVIPENIDAIRAALRLAESAEETMRVTDKVLNVGLQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcccgttgctgttaacggttacggtacgatcgggaaaagggtcgcagaagcg
ataaggcagatgcccgacttggagctgaagggtatcgtaaagtacacacccgactacagc
gtcctagtggcctacagacagggcatcccaatatatgtgccgaagggaaaagaaggggtg
ttcgaagaagtcggggttaagccctccgggactgtcgacgagttgttcgggtcggttagt
ctcgtcgtagacgcatcccctggtggaaaaggggcgcagaacaagagggtctacgtggag
cggggcctaagcgccctcttcgagggcggagagagcccggatgtagcagaggtcagcttt
agcacgctctgcaactaccggcaggcccttggtaaaaagtacattagagtggtcagctgc
aatactacggccctgcttaggctgatatgcctcctagacaggcacatcggcgtcaggaag
gccagagcggttattgtcagaagagctagtgacccaaaggaggacaaaggtatcgtcaac
acagtgaagctagacccacccagtatacccagccaccacgcaatagacgtgaaaacagtc
ttacccgacctggacattgagactgtcgcacttatagtgccgacgacactgatgcacgtc
cacgtcgtacacatccaaaccaagaggagtaccagcatagacgaggtcgtggagacgttg
tctagtactcctaggatagttgtcctggaaggcgcaaagataggtatagactccaccagc
aagatcgtcgagttcgctagagacctcggcaggaaaaggtacgacatctacgagaacgtg
gtttggagggacatgatcaaagtaaacggagacgagctaactatagttcaggcagtccac
caagaagcaatagtgataccagagaacatcgacgcgataagagcggctctgcgtctagcc
gagagcgcggaggagacgatgagggtgacagacaaggttcttaacgtcggtttacaacgt
taa

DBGET integrated database retrieval system