KEGG   Thermogladius cellulolyticus 1633: TCELL_1375Help
Entry
TCELL_1375        CDS       T02127                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
thg  Thermogladius cellulolyticus 1633
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:thg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:thg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:thg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1308356..1309378
Genome map
AA seq 340 aa AA seqDB search
MKAPVAVNGYGTIGKRVAEAIRQMPDLELKGIVKYTPDYSVLVAYRQGIPIYVPKGKEGV
FEEVGVKPSGTVDELFGSVSLVVDASPGGKGAQNKRVYVERGLSALFEGGESPDVAEVSF
STLCNYRQALGKKYIRVVSCNTTALLRLICLLDRHIGVRKARAVIVRRASDPKEDKGIVN
TVKLDPPSIPSHHAIDVKTVLPDLDIETVALIVPTTLMHVHVVHIQTKRSTSIDEVVETL
SSTPRIVVLEGAKIGIDSTSKIVEFARDLGRKRYDIYENVVWRDMIKVNGDELTIVQAVH
QEAIVIPENIDAIRAALRLAESAEETMRVTDKVLNVGLQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcccgttgctgttaacggttacggtacgatcgggaaaagggtcgcagaagcg
ataaggcagatgcccgacttggagctgaagggtatcgtaaagtacacacccgactacagc
gtcctagtggcctacagacagggcatcccaatatatgtgccgaagggaaaagaaggggtg
ttcgaagaagtcggggttaagccctccgggactgtcgacgagttgttcgggtcggttagt
ctcgtcgtagacgcatcccctggtggaaaaggggcgcagaacaagagggtctacgtggag
cggggcctaagcgccctcttcgagggcggagagagcccggatgtagcagaggtcagcttt
agcacgctctgcaactaccggcaggcccttggtaaaaagtacattagagtggtcagctgc
aatactacggccctgcttaggctgatatgcctcctagacaggcacatcggcgtcaggaag
gccagagcggttattgtcagaagagctagtgacccaaaggaggacaaaggtatcgtcaac
acagtgaagctagacccacccagtatacccagccaccacgcaatagacgtgaaaacagtc
ttacccgacctggacattgagactgtcgcacttatagtgccgacgacactgatgcacgtc
cacgtcgtacacatccaaaccaagaggagtaccagcatagacgaggtcgtggagacgttg
tctagtactcctaggatagttgtcctggaaggcgcaaagataggtatagactccaccagc
aagatcgtcgagttcgctagagacctcggcaggaaaaggtacgacatctacgagaacgtg
gtttggagggacatgatcaaagtaaacggagacgagctaactatagttcaggcagtccac
caagaagcaatagtgataccagagaacatcgacgcgataagagcggctctgcgtctagcc
gagagcgcggaggagacgatgagggtgacagacaaggttcttaacgtcggtttacaacgt
taa

DBGET integrated database retrieval system