KEGG   Thermogladius cellulolyticus: TCELL_1406Help
Entry
TCELL_1406        CDS       T02127                                 

Definition
ATP-dependent phosphofructokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
thg  Thermogladius cellulolyticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TCELL_1406
Enzymes [BR:thg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TCELL_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1344390..1345319)
Genome map
AA seq 309 aa AA seqDB search
MSSDKNIDLVAVGHALVDIRLVVSEFPQPDQEADVKKQTWGAGGSAVNVSIAGRRLGLKT
SVIAKIGFDNFGRLIVDELLRENVDISGLRIGLLPTGVTIVVIDSRGNIIMYGYKGVAEE
LAPTEVSEYVISKSKWVHVASLNLETTTRVLDIAEKHGVATSWDPGRLISKRPWSELERV
IKRVRAVLANEQEYQNMTGVSDYKQAASKVLEAGAEIAVVKRGEKGAYLKTRDVEEEVPA
FSVREVVDTTGAGDAFAAGFIAGLLRGYSLRKALSYANAVAALKITRLGSHEAPSHEEVV
DFIWEKGIV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgagtagcgataagaacatagacctcgtggccgtcgggcacgccctggtcgacataagg
ctcgtagtaagcgagttcccccagccagaccaggaggcggacgttaagaagcagacgtgg
ggcgccggcgggtcggctgtgaacgtctctatagccggaaggaggctagggctgaagacg
tctgtcatcgccaagataggcttcgacaacttcggcaggctcatcgtggacgagcttcta
agggagaacgtggacatcagcggtctcaggatcggactcctccccaccggtgtgaccatc
gtggtgatcgactcgcggggaaatatcataatgtacggctataaaggagtagccgaagag
ctggcacccacagaggtcagcgagtacgtcatatcgaagagtaagtgggttcacgtggcg
agcctaaacctagaaacaactacgagagtgctcgatatagccgagaaacacggggtggcg
acttcttgggacccagggcgcctgatatcgaagaggccctggagcgagttagagagggtc
ataaagagggtgagagcagtactcgccaacgaacaagagtaccagaacatgacgggggta
agcgactacaagcaggctgcctccaaggtgctggaggcgggggcagagatcgcggtggtg
aaacggggggagaaaggggcctacctcaagaccagggatgtcgaggaggaggtccccgct
ttcagtgtaagagaggtcgtcgacacgactggcgcaggcgacgcatttgcggcagggttt
atcgcgggtttgttgcggggttacagcttgaggaaagcgctctcttacgccaacgctgtc
gcagcccttaaaatcacaaggctgggctcgcacgaggcccccagccacgaggaggtcgtg
gacttcatctgggagaaaggaattgtatag

DBGET integrated database retrieval system