KEGG   Thiomonas arsenitoxydans: THI_0007Help
Entry
THI_0007          CDS       T02347                                 

Gene name
glk
Definition
Glucokinase (Glucose kinase) glk (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THI_0007 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THI_0007 (glk)
   00052 Galactose metabolism
    THI_0007 (glk)
   00500 Starch and sucrose metabolism
    THI_0007 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    THI_0007 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    THI_0007 (glk)
   00524 Butirosin and neomycin biosynthesis
    THI_0007 (glk)
Enzymes [BR:thi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     THI_0007 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(11840..12820)
Genome map
AA seq 326 aa AA seqDB search
MTSNLSLPATRLVGDIGGTNARFALHTAQGLSDIRVLPTADYARFADALLAYLAATGATA
VRHVAIGIANPVYGDQIRMTNHHWAFSIAQTRAELGLETFLVLNDFAVLARALPELPAAE
LVQVGGGSAVPGAPLALLGAGTGLGVSGLIPDGQGGWTPLAGEGGHVSFAPFDEREVAIW
RLAHARFGHVSAERLLSGAGMAFLHQALGQIAGQTPPERSAAEITRLALDGSDALCHDTV
TLFCTLLGTVAADLAITLGARGGVYIGGGIVPRLGDFFRHCPFRQRFEDKGRTSPYLRDI
PVWVIHSPWPALLGAAAALDQFLQAH
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgaatctctcccttcctgccacccgcctggtcggcgacatcggcggcaccaat
gcccgattcgccctgcacaccgcgcaagggctgagcgatattcgcgtgctgcccacggcg
gattacgcccgctttgccgatgcgctgctcgcctatctcgccgccacgggcgcgaccgcc
gtgcgccatgtcgccatcggcatcgccaacccggtgtatggcgaccagattcgcatgacc
aaccatcactgggccttttccatcgcccagacccgcgccgaactggggctggagaccttt
ctggtgctcaacgatttcgctgtgctcgcgcgcgccctgcccgagttgcccgcggccgag
ctcgttcaggtgggcggcggcagcgccgtgcccggcgcgccgctagcgctgctgggcgcg
ggcaccggcctgggcgtgtcgggcctgattcccgacggacaagggggttggacgccgctg
gcgggcgagggcgggcatgtgagcttcgccccttttgatgagcgcgaagtggccatctgg
cgtctggcgcatgcgcgcttcggccatgtttcggcagagcgtttgctaagcggcgccggg
atggcgtttttgcatcaggcgctcggacagatcgccgggcagacgccgcccgagcgcagc
gccgctgagatcacccgcctggccctggacggcagcgacgcgctatgccacgacacagtg
acgctgttctgcaccttgctgggcacggtggcggccgatctggccatcaccctgggggcg
cgcggcggggtgtatatcggcggcggcatcgtgccgcggctgggcgatttctttcggcat
tgcccgttccgccagcgcttcgaagacaaagggcgcacctcgccgtatttacgcgatatt
ccggtctgggtgatccacagcccctggcctgcactgcttggcgcagccgcggcgcttgat
cagtttctgcaggcgcactga

DBGET integrated database retrieval system