KEGG   Thiomonas arsenitoxydans: THI_0111Help
Entry
THI_0111          CDS       T02347                                 

Definition
(GenBank) putative Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    THI_0111
Enzymes [BR:thi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     THI_0111
Transporters [BR:thi02000]
 Other Transporters
  Pores ion channels [TC:1]
   THI_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C GST_N GST_C_3 GST_C_5 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CAZ86869
UniProt: D6CQH8
Position
109167..109787
Genome map
AA seq 206 aa AA seqDB search
MKLIGSLTSPYVRKVRITLAEKKIDAKWEEENVWSDATQIGRSNPLGKVPCLVLDDGEAI
FDSRVIVEYLDTLTPVGKLIPGGGRERAEVRTWEALADGVMDAAATARLEQTWPGRTEAQ
RSPAWIARQMGKVEAGVKAMAAGLADKPFCCGNHFTLADIAVGAALGYVVFRFPEMDWQQ
QYPNLAKLYDKLMQRPSFRDTVPPQG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcatcggatccctgaccagtccctacgttcgcaaagtgcgcattacgttggcc
gagaaaaaaatcgacgccaagtgggaagaagagaacgtctggtcggacgcgacccagatc
ggccgctccaatccgctgggcaaggtgccttgcctagtgctcgatgatggcgaggcgatt
ttcgactcgcgggtgatcgtcgaatatctcgataccctcacgcccgtgggcaaactcatt
cccggcggtggacgcgagcgtgccgaagtccgtacctgggaggctctggccgatggggtg
atggacgccgcggccacggcccggctggagcagacctggcccggccgcaccgaagcgcag
cgcagcccggcctggattgcgcggcagatgggcaaggtggaggccggggtcaaggccatg
gcggccggactggctgacaagccgttttgctgcggcaaccacttcaccctggccgacatt
gccgtgggagccgcgttgggctatgtggtgttccgttttcccgaaatggactggcagcag
cagtaccccaacctcgccaagctttacgacaagttgatgcagcgcccgtcgttccgcgac
acggtgccgccgcaaggctga

DBGET integrated database retrieval system