KEGG   Thiomonas arsenitoxydans: THI_0191Help
Entry
THI_0191          CDS       T02347                                 

Definition
putative agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    THI_0191
Enzymes [BR:thi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     THI_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191641..192594
Genome map
AA seq 317 aa AA seqDB search
MVQHAFAYLSQQRFLGAAASAENAPTPRFGVAGVAWDGAVTNRPGARFGPNAIRQASQML
CDATHPFFDLSPTADLCDHGDLYLPNTSLETMRAALEAQARTLLARQHMVWLGGDHSITL
SLLRALRAVHGQPLAVLHFDAHCDTWTDHFGEPSGHGTWVYEAVQEGLVVPQGVVQVGIR
SAAERAAREYVNTIGGRVITARELRGLESPSQLAPITADIRARLAASNAPVYVTLDIDCL
DPAFAPGTGTPEPGGLSSAQVLSLLEELCAMQLPFVGMDCVEVSPPYDHAELTSNIAALC
VWTYLCARLASEKTVSP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacacgcttttgcctatctgtcacagcaacggtttctcggcgcagcagccagc
gccgagaatgcgccgacgccccgcttcggcgtggccggcgtggcctgggacggggcggtg
accaaccgccccggcgcccgattcgggccgaacgccatccgccaggccagccagatgctg
tgcgatgccacgcacccgtttttcgatctttcgcccaccgcagatctgtgcgatcacggc
gatctgtatctgcccaacaccagcctggagacgatgcgcgccgcgctcgaagcccaggcg
cgaacactcttggcgcgtcagcacatggtgtggctgggtggcgatcattccatcaccctg
tcgctgctgcgcgccctgcgcgcggtgcatggccagccgctggcggtgctgcatttcgat
gcgcattgcgacacctggaccgaccacttcggcgagccatcggggcacggcacctgggtt
tacgaggcggtgcaggaagggctggtggtgccgcagggtgttgtgcaggtgggcatccgc
tcggccgccgagcgcgccgcgcgcgagtacgtcaacaccatcggtggccgggtgatcacc
gcgcgcgaactgcgcggcctggagagcccgtcgcagctcgcacccatcaccgccgacatc
cgcgcccgattggccgcgagcaatgccccggtgtatgtcacgctcgacatcgactgtctc
gaccccgccttcgcccccggcaccggcacgcccgagcccggcggcttgagcagcgcgcag
gtgctgtcgctgcttgaagagttgtgcgccatgcagctgccctttgtcggcatggactgc
gtggaggtgtcgccgccctacgaccacgccgaactcacctccaatatcgcggcgctgtgc
gtctggacttatctgtgcgcgcggctcgcttctgaaaaaactgtctccccctga

DBGET integrated database retrieval system