KEGG   Thiomonas arsenitoxydans: THI_0338Help
Entry
THI_0338          CDS       T02347                                 

Gene name
fadB
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00071  Fatty acid degradation
thi00280  Valine, leucine and isoleucine degradation
thi00281  Geraniol degradation
thi00310  Lysine degradation
thi00360  Phenylalanine metabolism
thi00362  Benzoate degradation
thi00380  Tryptophan metabolism
thi00410  beta-Alanine metabolism
thi00627  Aminobenzoate degradation
thi00640  Propanoate metabolism
thi00650  Butanoate metabolism
thi00903  Limonene and pinene degradation
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
thi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    THI_0338 (fadB)
   00650 Butanoate metabolism
    THI_0338 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    THI_0338 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    THI_0338 (fadB)
   00310 Lysine degradation
    THI_0338 (fadB)
   00360 Phenylalanine metabolism
    THI_0338 (fadB)
   00380 Tryptophan metabolism
    THI_0338 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    THI_0338 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    THI_0338 (fadB)
   00281 Geraniol degradation
    THI_0338 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    THI_0338 (fadB)
   00627 Aminobenzoate degradation
    THI_0338 (fadB)
   00930 Caprolactam degradation
    THI_0338 (fadB)
Enzymes [BR:thi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     THI_0338 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: CAZ87088
UniProt: D6CR47
Position
complement(340785..341570)
Genome map
AA seq 261 aa AA seqDB search
METPDDAVVLTETRGHVGLITLNRPKQLNALNDALMDALGAALKAFDADPAIGCMVVTGS
DKAFAAGADISAMAKKTFPASYTEDFITRNWEAMMQIRKPVIAAVRGFALGGGCELAMMC
DLIVAADNAQFGQPEIKLGIIPGAGGTQRLTRAVGKAKAMDLILTGRMMDALEAERSGLV
ARVVPLQQTLDEAVAMAETMAGFSQPSVLMAKESVNRAFESSLSEGLRFERRLFQSLFAT
ADQKEGMAAFLEKRKPLFTNK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggagacccctgacgacgccgtcgtcctgaccgaaacccgaggccacgtcggcctcatc
accctcaatcgacccaagcaactcaacgccctgaacgacgccctgatggacgcgctgggc
gccgcgctgaaagcgtttgacgcggatccagccatcggctgcatggtcgtcaccggcagc
gacaaggccttcgccgccggggccgacatctcggccatggcgaaaaagacctttccggcc
agctacaccgaagacttcatcacccgcaactgggaagcgatgatgcagatccgcaagccg
gtgattgcggcggtgcgcggcttcgcgctgggcgggggctgcgagctggcgatgatgtgc
gatctcatcgtggccgccgacaacgcccagttcggccagcccgaaatcaagctcggcatc
attcccggcgccggcggcacccagcggctgacgcgcgccgtgggcaaagccaaggccatg
gatctgatcctcaccggccggatgatggacgcgcttgaggccgagcgcagcggcctggtc
gcgcgggtcgtgccgctgcagcagacactcgatgaggccgtggcgatggccgaaaccatg
gccggcttctcgcagccttcggtgctcatggccaaggaaagcgtgaaccgcgcgtttgaa
tcgtcgctgtccgaaggtttgcgtttcgagcgtcggctgtttcagtcgctgttcgctacg
gccgaccagaaggagggtatggcggctttcctggaaaaacgaaaaccgcttttcacgaac
aaatga

DBGET integrated database retrieval system