KEGG   Thiomonas arsenitoxydans: THI_0382Help
Entry
THI_0382          CDS       T02347                                 

Definition
putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) ispE (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    THI_0382
Enzymes [BR:thi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     THI_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
388703..389734
Genome map
AA seq 343 aa AA seqDB search
MRALFNLPAPAKINWFLHVTGKRPDGYHTLQTVFQFIDWCDTLDLIRRDDGLIHRIGADE
LPQDDLCVRAARLLQQATQCESGVDIHLRKCIPQQAGLGGGSSDAATVLIGLNRLWRLDL
PRAKLMQLALQLGADVPIFIYGRNAWAEGVGEQLQPIDLPTSSFAVVHPARGLSTRAVFS
TLDLTTKKPEETIAGFAEWLGEFFAPDGRQKNRHQKSQSKNCQQDDQRSSLCPVWGRNDL
QPGAEALEPEVTQALQILHTALMGPLAAHSPTLRSELLFDARMTGSGSAVFALIGASDRS
GLPSRHGPSDEVLGGLPDLLPEGWQGRLCKGLREHPLRDWIDA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccctgttcaatctgcccgccccggcgaaaatcaactggtttttgcacgtcacc
ggcaagcgcccagacggctatcacaccctgcagacggtctttcagttcatcgattggtgc
gacacgctcgatctgatccggcgtgacgatggtctcatccaccgcatcggcgctgacgaa
ctgccgcaagacgacctttgcgtgcgcgccgcccgcctgctccaacaggcgacgcagtgc
gaaagcggcgtcgatattcatctgcgcaagtgcattccgcaacaggccgggctcggaggc
ggaagttccgatgctgccacggtactgatcggcctcaaccgtctctggcgcctcgatctg
ccgcgcgccaaactgatgcaactcgccttgcaactcggcgccgacgtgccgattttcatc
tacggccgcaacgcctgggccgagggcgtcggcgagcagttgcagccaatcgatctgccc
acgtcgagttttgctgtggtgcatccggcacgcggcctgtccacacgtgcggtgttttcc
acccttgacttgacaaccaaaaaacccgaagaaacaatagcaggctttgctgaatggctg
ggcgaatttttcgcaccagatgggcggcagaaaaatcggcaccagaaaagtcagagcaaa
aactgtcaacaagacgatcagcgaagcagtctttgccctgtctggggcagaaacgatttg
cagcccggcgccgaggcgctggagcctgaggtgactcaggcactgcagattttgcatact
gcgttgatggggccgctggcagcacactcgccgacgttgcgttctgagttgcttttcgat
gcgcgaatgacgggttctggcagcgcagtttttgctttgatcggtgcgtcagatcgatct
ggtttgccgagcaggcacgggccgtctgatgaggtgttgggtggtttgccggacttgttg
cctgagggttggcagggccggttgtgcaagggtttgcgcgagcatccgttgcgcgattgg
attgacgcataa

DBGET integrated database retrieval system