KEGG   Thiomonas sp. 3As: THI_0382Help
Entry
THI_0382          CDS       T02347                                 

Definition
putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) ispE (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
thi  Thiomonas sp. 3As
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:thi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
388703..389734
Genome map
AA seq 343 aa AA seqDB search
MRALFNLPAPAKINWFLHVTGKRPDGYHTLQTVFQFIDWCDTLDLIRRDDGLIHRIGADE
LPQDDLCVRAARLLQQATQCESGVDIHLRKCIPQQAGLGGGSSDAATVLIGLNRLWRLDL
PRAKLMQLALQLGADVPIFIYGRNAWAEGVGEQLQPIDLPTSSFAVVHPARGLSTRAVFS
TLDLTTKKPEETIAGFAEWLGEFFAPDGRQKNRHQKSQSKNCQQDDQRSSLCPVWGRNDL
QPGAEALEPEVTQALQILHTALMGPLAAHSPTLRSELLFDARMTGSGSAVFALIGASDRS
GLPSRHGPSDEVLGGLPDLLPEGWQGRLCKGLREHPLRDWIDA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccctgttcaatctgcccgccccggcgaaaatcaactggtttttgcacgtcacc
ggcaagcgcccagacggctatcacaccctgcagacggtctttcagttcatcgattggtgc
gacacgctcgatctgatccggcgtgacgatggtctcatccaccgcatcggcgctgacgaa
ctgccgcaagacgacctttgcgtgcgcgccgcccgcctgctccaacaggcgacgcagtgc
gaaagcggcgtcgatattcatctgcgcaagtgcattccgcaacaggccgggctcggaggc
ggaagttccgatgctgccacggtactgatcggcctcaaccgtctctggcgcctcgatctg
ccgcgcgccaaactgatgcaactcgccttgcaactcggcgccgacgtgccgattttcatc
tacggccgcaacgcctgggccgagggcgtcggcgagcagttgcagccaatcgatctgccc
acgtcgagttttgctgtggtgcatccggcacgcggcctgtccacacgtgcggtgttttcc
acccttgacttgacaaccaaaaaacccgaagaaacaatagcaggctttgctgaatggctg
ggcgaatttttcgcaccagatgggcggcagaaaaatcggcaccagaaaagtcagagcaaa
aactgtcaacaagacgatcagcgaagcagtctttgccctgtctggggcagaaacgatttg
cagcccggcgccgaggcgctggagcctgaggtgactcaggcactgcagattttgcatact
gcgttgatggggccgctggcagcacactcgccgacgttgcgttctgagttgcttttcgat
gcgcgaatgacgggttctggcagcgcagtttttgctttgatcggtgcgtcagatcgatct
ggtttgccgagcaggcacgggccgtctgatgaggtgttgggtggtttgccggacttgttg
cctgagggttggcagggccggttgtgcaagggtttgcgcgagcatccgttgcgcgattgg
attgacgcataa

DBGET integrated database retrieval system