KEGG   Thiomonas arsenitoxydans: THI_0421Help
Entry
THI_0421          CDS       T02347                                 

Definition
putative Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
thi  Thiomonas arsenitoxydans
Brite
Enzymes [BR:thi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     THI_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
432071..432922
Genome map
AA seq 283 aa AA seqDB search
MSAGSKSPQRFVHWPARQALDAALSKAPTAPPPPRGQLGGARTVALPVPREPQTRGASQG
PSRCLPRQAGLDSDAVRRGMVDKLRQSGHFDERVLQALQDVPRHHFVDPGLAAQAYLDNA
LPIGFEQTISKPSVVARGLDAALKALAPRANLGKVLDIGTGCGYAAAVTARVAADVYSVE
RIRALHDLARNNLRALRVPNLRLILGDGMLGCPQGAPFDAILSGAAALTLPQVWLDQLVV
GGVLIAPIGDPQQLLLYRKRSATTFDVQQLEGAKFVPLKSGLT
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcgggaagcaagtcgccgcagcgctttgtgcactggcctgcgcgccaagcgctt
gatgccgcgctgagcaaggcgcccacagcgccacccccgccgagagggcagttggggggc
gcgcgaaccgttgcgttgcccgttccacgtgaaccgcaaacgcgcggagcgtcgcaaggc
ccgtcgcgctgcctgccgcgtcaggccggacttgactcggacgcggtgcgtcgcggcatg
gtcgacaaattgcggcaatcgggccactttgacgagcgggtgctgcaggccttgcaggat
gtgccacgccatcatttcgtcgatcctgggctggccgctcaagcctatctcgacaacgca
ctgcccatcggatttgaacaaaccatctccaagccctcggtcgtggcccgcggcctagat
gcggcgctcaaggccctggcgccgcgcgccaatctgggcaaggtgctcgacatcggcacc
ggctgtggctacgccgcggccgtgacggccagggtggcggcagacgtttacagcgtcgag
cgcatacgcgcgctgcacgatctggcgcgcaacaatctgcgcgccttgcgcgtgccgaac
ctgcgtttgattttgggcgacggtatgctgggatgcccgcagggcgctccgttcgacgcg
attttgtcgggggcggcggcgctgactttgccgcaggtctggctcgaccagttggtggtg
ggcggggtgctcattgcgcccatcggcgacccgcagcaactcttgctgtaccgcaagcgc
tcagccaccacattcgacgtgcagcaactcgaaggcgccaaattcgtccccttaaaatct
ggtttgacttga

DBGET integrated database retrieval system