KEGG   Thiomonas arsenitoxydans: THI_0480Help
Entry
THI_0480          CDS       T02347                                 

Gene name
acoC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system (Acetoin dehydrogenase E2 component) (Dihydrolipoamide acetyltransferase component of acetoin cleaving system) (Fast-migrating protein) (FMP)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00010  Glycolysis / Gluconeogenesis
thi00020  Citrate cycle (TCA cycle)
thi00620  Pyruvate metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
thi01200  Carbon metabolism
Module
thi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THI_0480 (acoC)
   00020 Citrate cycle (TCA cycle)
    THI_0480 (acoC)
   00620 Pyruvate metabolism
    THI_0480 (acoC)
Enzymes [BR:thi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     THI_0480 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl Ndr PGAP1 Thioesterase Esterase_phd PTS_EIIA_1 DUF915 Abhydrolase_5 BAAT_C Lipase_3 DUF1057 Esterase Biotin_lipoyl_2 DUF676 HlyD_3 DUF900 Pro_CA PAF-AH_p_II
Motif
Other DBs
NCBI-ProteinID: CAZ87223
UniProt: D6CRI2
Position
complement(485354..486469)
Genome map
AA seq 371 aa AA seqDB search
MSTTLTPIIMPKWGLEMKEGTITAWLVDVGAVIEVGTPLMEVETDKISNAVEAPDPGLLR
RKVAQEGQTLPVKALLGVMADAAVSEAEIDTYVANYVVPAVATSEDDDPPPYSFADIDGL
HVRYARRGLGDGVPVLFLHGFGGDLDNWLFNLDVLAEVAPVIALDLPGHGQSTSRLPGTA
LADLASFVVHFLDELHVERVHVVGHSMGGAIASQMTLDYPGRVASLALINSAGLGTEINA
GYTEGFVAATSRRELKPLVEQLFANPELVSRSLLENLLKYKRLDGVPELLQALSAAQFGS
GQQAEQPGLRLGGVGKPVLVVWGREDRIIPSSHAVHAPAGATVEVLEGAGHMTMMERANE
INALLKRHVTG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagcactactctcactcccatcatcatgcccaaatggggcttggaaatgaaggaaggc
accattacggcgtggctggtcgatgttggagcggtcatcgaggtgggcacaccgctgatg
gaagtcgagaccgacaagatctccaacgcagtggaggcgcccgatcccggcctcctgcgc
cgcaaggtggcgcaggaggggcagaccctgccagtcaaggcgctcttgggcgtaatggcc
gatgcggctgtcagcgaggccgagatcgatacttacgtcgccaactatgtggtgcccgct
gtcgcgacgagcgaagacgacgacccgccgccttacagtttcgccgacatcgacggcttg
cacgtgcgctatgcgcgacggggtttgggcgacggcgtgccagtgctgttcctgcacggt
ttcggcggcgatctcgacaactggctgttcaatctcgacgtactcgccgaagtggctcca
gtcatcgcgctggatctgcccgggcacggacagtccacttcgaggctgccaggcaccgca
cttgccgacctagccagctttgtcgtgcattttctcgatgaactgcacgtcgagcgtgta
cacgtggtggggcattcgatgggcggcgcaatcgcctcacagatgaccctggactatccc
gggcgggtggcatcgttggcgctaatcaacagcgcagggcttggcaccgagatcaacgcg
ggctacaccgaaggcttcgttgccgcgacctcgcgccgcgagctcaagcccttggtcgag
cagttgtttgccaacccagaactggtcagccgctcgttgctggagaacctgctcaagtac
aagcggctggacggtgtgcccgagctgctgcaggccttgagcgcagctcagttcggctca
ggtcagcaggccgagcagcccggtttgcgcttgggcggtgtcggcaaacccgtgcttgtg
gtctggggccgcgaggatcggatcatcccctcctcccacgccgtgcacgcgcctgcgggc
gccaccgtggaggttctggaaggtgccggccacatgaccatgatggagcgggccaacgag
atcaatgcgctgctcaaacgccacgtcaccggttga

DBGET integrated database retrieval system