KEGG   Thiomonas arsenitoxydans: THI_0636Help
Entry
THI_0636          CDS       T02347                                 

Gene name
proB
Definition
Glutamate 5-kinase (Gamma-glutamyl kinase) (GK) (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THI_0636 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    THI_0636 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    THI_0636 (proB)
Enzymes [BR:thi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     THI_0636 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634890..636017
Genome map
AA seq 375 aa AA seqDB search
MQPSSSVVQSARRVIIKAGSSLVTNEGRGVDLDAVSRWAGQIAGLRSAGKDVILVSSGAI
AEGMRRLGWSQRPREMHQLQAAAAVGQMGLAQAYETAFRERGMVAAQVLLTHADLADRQR
YLNARTTLLTLLEQGVVPVINENDTVVTDEIKFGDNDTLGALVTNLVEGDVLIILTDQSG
LYSADPRKHADATLIAQADAEDATLQAMAGGAGTGIGTGGMATKVTAARRAARSGAHTVI
ASGREPDVLLRLARGEIVGTQLLAGHAKLAARKQWMADHLQLRGWVRVDEGAARRLRAQG
ASLLPVGVVEVQGDFDRGDVIAVRDASGAEVARGLSNYAASQARRIMRHPSADIEAILGF
SEEPELIHRDNMVFL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcagccttccagctctgtcgtgcagtcggcgcggcgcgtcatcatcaaggccggttcc
agtctggtcaccaatgaagggcgtggcgtcgatctcgatgccgtgtcccgctgggcgggg
cagatcgccggcctgcgctcggcaggcaaggacgtcattctggtctccagcggcgccatc
gcagaagggatgcgtcgcttgggctggtcgcaacgtccgcgcgagatgcaccagttgcag
gcggctgcggccgtcggccagatgggcttggcgcaagcttacgaaacggccttccgggag
cgcggcatggtcgccgcgcaggtgttgttgacccatgccgacctggcggatcgccagcgc
tatctcaacgcccgcacgaccttgctgaccttgttggagcagggtgtcgtgccggtcatc
aacgaaaacgacaccgtggtcaccgacgagatcaagtttggtgacaacgacaccttgggt
gcgctggtcaccaatctggtggaaggcgatgtgctgatcatcctcactgaccaatcgggc
ctgtacagcgcggacccgcgcaaacatgccgacgccacgctgatcgcccaagccgacgcc
gaggacgccacgctgcaggccatggccggcggtgctggaacgggaatcggcaccggcggg
atggcgaccaaggtcacggcagcgcggcgtgcggcgcgcagtggcgcgcataccgtgatt
gccagcggacgcgagcccgatgtgctgctccgcttggcgcggggcgagatcgttggcact
cagctactggctggtcacgccaagcttgccgcgcgcaaacagtggatggccgatcatttg
caactgcgcggctgggtcagggtggatgaaggcgcagcccggcgtttgcgcgcacaaggg
gccagcttgctgccggttggcgtggtggaggtacagggcgacttcgatcgaggtgacgtc
atcgccgtgcgcgatgcaagcggagcggaagtggcgcggggcctgagtaattacgcggct
tcacaggcccggcgcatcatgcgccacccgtctgccgacatcgaggccatactcggtttc
agcgaggagcccgagctgattcaccgggacaatatggttttcctgtag

DBGET integrated database retrieval system