KEGG   Thiomonas sp. 3As: THI_0636Help
Entry
THI_0636          CDS       T02347                                 

Gene name
proB
Definition
Glutamate 5-kinase (Gamma-glutamyl kinase) (GK) (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
thi  Thiomonas sp. 3As
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:thi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:thi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634890..636017
Genome map
AA seq 375 aa AA seqDB search
MQPSSSVVQSARRVIIKAGSSLVTNEGRGVDLDAVSRWAGQIAGLRSAGKDVILVSSGAI
AEGMRRLGWSQRPREMHQLQAAAAVGQMGLAQAYETAFRERGMVAAQVLLTHADLADRQR
YLNARTTLLTLLEQGVVPVINENDTVVTDEIKFGDNDTLGALVTNLVEGDVLIILTDQSG
LYSADPRKHADATLIAQADAEDATLQAMAGGAGTGIGTGGMATKVTAARRAARSGAHTVI
ASGREPDVLLRLARGEIVGTQLLAGHAKLAARKQWMADHLQLRGWVRVDEGAARRLRAQG
ASLLPVGVVEVQGDFDRGDVIAVRDASGAEVARGLSNYAASQARRIMRHPSADIEAILGF
SEEPELIHRDNMVFL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcagccttccagctctgtcgtgcagtcggcgcggcgcgtcatcatcaaggccggttcc
agtctggtcaccaatgaagggcgtggcgtcgatctcgatgccgtgtcccgctgggcgggg
cagatcgccggcctgcgctcggcaggcaaggacgtcattctggtctccagcggcgccatc
gcagaagggatgcgtcgcttgggctggtcgcaacgtccgcgcgagatgcaccagttgcag
gcggctgcggccgtcggccagatgggcttggcgcaagcttacgaaacggccttccgggag
cgcggcatggtcgccgcgcaggtgttgttgacccatgccgacctggcggatcgccagcgc
tatctcaacgcccgcacgaccttgctgaccttgttggagcagggtgtcgtgccggtcatc
aacgaaaacgacaccgtggtcaccgacgagatcaagtttggtgacaacgacaccttgggt
gcgctggtcaccaatctggtggaaggcgatgtgctgatcatcctcactgaccaatcgggc
ctgtacagcgcggacccgcgcaaacatgccgacgccacgctgatcgcccaagccgacgcc
gaggacgccacgctgcaggccatggccggcggtgctggaacgggaatcggcaccggcggg
atggcgaccaaggtcacggcagcgcggcgtgcggcgcgcagtggcgcgcataccgtgatt
gccagcggacgcgagcccgatgtgctgctccgcttggcgcggggcgagatcgttggcact
cagctactggctggtcacgccaagcttgccgcgcgcaaacagtggatggccgatcatttg
caactgcgcggctgggtcagggtggatgaaggcgcagcccggcgtttgcgcgcacaaggg
gccagcttgctgccggttggcgtggtggaggtacagggcgacttcgatcgaggtgacgtc
atcgccgtgcgcgatgcaagcggagcggaagtggcgcggggcctgagtaattacgcggct
tcacaggcccggcgcatcatgcgccacccgtctgccgacatcgaggccatactcggtttc
agcgaggagcccgagctgattcaccgggacaatatggttttcctgtag

DBGET integrated database retrieval system