KEGG   Thiomonas sp. 3As: THI_0733Help
Entry
THI_0733          CDS       T02347                                 

Gene name
glpK
Definition
Glycerol kinase (ATP:glycerol 3-phosphotransferase) (Glycerokinase) (GK) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
thi  Thiomonas sp. 3As
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:thi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721255..722760
Genome map
AA seq 501 aa AA seqDB search
MPSLIAALDQGTSSSRTLIVDAQGRVLASAQREFTQHYSQPGWVEHDPLDIWATQSATLT
EALARAAAKLSDLAAIGITNQRETVVLWERATGRPLANAIVWQDRRTAGICAQLAADGHA
PELQARTGLLPDAYFSATKLAWLLDHIPGARARAERGELAAGTIDSWLVWNLSGGVTHLT
DVSNASRTLLCNLHTGDWDDELLALLRVPRAVLPAIVPNCGALAVARLGGLNIPITGMAG
DQQAALFGQACLQPGMAKNTYGTGCFALQHTGTQAVRSQQRLLTTIAWKLGDDQPLHYAL
EGGVFIAGAAVQWLRDGLGLVHSAQEAQQLADSVPDSGGVLLVPAFTGLGAPHWDAQARG
LLIGITRGTTAAQVARATIDSLAYQSAELFAAMQADVAAQGGPPLTELRVDGGAAVNDTL
MQFQADLLGVPVVRPVQAESTALGAAYLAGLGAGLWPNAAALPALWQEQRRFTPQMSTDE
RKARMARWRRAVERARDWADD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccctcattgattgccgcgctcgatcaaggtacgtccagctcgcgcaccctcatcgtc
gatgcgcagggccgggtgctggccagcgcgcagcgcgagttcacccagcactactcgcaa
cccggctgggtggaacatgacccgctggacatctgggccacgcaaagcgccaccctcacc
gaagctctggcccgcgccgcagcgaagctgagcgatctcgccgccatcggcatcaccaac
cagcgcgaaaccgtggtgctgtgggagcgtgccaccggcaggccgctggccaacgccatc
gtctggcaagaccggcgcactgcgggcatctgcgcccagctcgcggcggacggccacgcg
cccgaactgcaagcgcgcaccggcctgttgcccgacgcctatttctcggccaccaagctg
gcctggctgctcgaccacattcccggcgctcgcgcccgcgctgaacgtggcgagctcgcc
gcaggcaccatcgacagctggctggtgtggaacctgagcggcggcgtgacccacctcacc
gatgtcagcaatgccagccgcaccctgctgtgcaatctccacaccggcgactgggacgac
gagttgctggcgctgctgcgcgtgccccgcgccgtgctgcctgccatcgtgcccaactgt
ggcgcgctagccgtggcacgtctgggcggtctgaacattcccatcaccggcatggccggc
gaccagcaggccgcgctgtttggccaggcctgtctgcagcccggcatggcgaaaaacacc
tacggcaccggctgcttcgcactgcagcacaccggcacgcaggcggtgcgctcacaacag
cgcctgctgaccaccattgcctggaagctcggcgacgatcagcccttgcattacgctctg
gaaggcggcgtgttcatcgccggggccgcggtgcaatggttgcgcgacggcctcggcttg
gtgcacagcgcgcaagaagcgcagcaactcgccgacagtgtgccagacagcggcggcgtg
ctgctcgtgcccgccttcaccggcctgggcgcgccgcactgggacgcacaggcgcgcggc
ctgctcatcggcatcacccgcggtaccacggcagcgcaggtcgcccgcgccaccatcgac
agcctggcttatcaaagcgccgagctgttcgccgccatgcaggccgacgtcgccgcgcag
ggcgggccgccgctgaccgaactacgggtggatggcggcgcggcggtaaacgacacgctg
atgcagtttcaggccgacctgctgggcgtgcccgtggtgcgccccgtgcaggccgagagc
acggcgctgggcgcggcctatctggccgggctgggcgcagggctgtggccgaacgcggct
gcgctgcccgcgctatggcaggaacaacgccgattcaccccgcaaatgagcaccgacgag
cgcaaggcgcgcatggctcgctggcgtcgcgcggtggagcgcgcccgcgactgggccgac
gactga

DBGET integrated database retrieval system