KEGG   Thiomonas arsenitoxydans: THI_0733Help
Entry
THI_0733          CDS       T02347                                 

Gene name
glpK
Definition
Glycerol kinase (ATP:glycerol 3-phosphotransferase) (Glycerokinase) (GK) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    THI_0733 (glpK)
Enzymes [BR:thi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     THI_0733 (glpK)
Exosome [BR:thi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THI_0733 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721255..722760
Genome map
AA seq 501 aa AA seqDB search
MPSLIAALDQGTSSSRTLIVDAQGRVLASAQREFTQHYSQPGWVEHDPLDIWATQSATLT
EALARAAAKLSDLAAIGITNQRETVVLWERATGRPLANAIVWQDRRTAGICAQLAADGHA
PELQARTGLLPDAYFSATKLAWLLDHIPGARARAERGELAAGTIDSWLVWNLSGGVTHLT
DVSNASRTLLCNLHTGDWDDELLALLRVPRAVLPAIVPNCGALAVARLGGLNIPITGMAG
DQQAALFGQACLQPGMAKNTYGTGCFALQHTGTQAVRSQQRLLTTIAWKLGDDQPLHYAL
EGGVFIAGAAVQWLRDGLGLVHSAQEAQQLADSVPDSGGVLLVPAFTGLGAPHWDAQARG
LLIGITRGTTAAQVARATIDSLAYQSAELFAAMQADVAAQGGPPLTELRVDGGAAVNDTL
MQFQADLLGVPVVRPVQAESTALGAAYLAGLGAGLWPNAAALPALWQEQRRFTPQMSTDE
RKARMARWRRAVERARDWADD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccctcattgattgccgcgctcgatcaaggtacgtccagctcgcgcaccctcatcgtc
gatgcgcagggccgggtgctggccagcgcgcagcgcgagttcacccagcactactcgcaa
cccggctgggtggaacatgacccgctggacatctgggccacgcaaagcgccaccctcacc
gaagctctggcccgcgccgcagcgaagctgagcgatctcgccgccatcggcatcaccaac
cagcgcgaaaccgtggtgctgtgggagcgtgccaccggcaggccgctggccaacgccatc
gtctggcaagaccggcgcactgcgggcatctgcgcccagctcgcggcggacggccacgcg
cccgaactgcaagcgcgcaccggcctgttgcccgacgcctatttctcggccaccaagctg
gcctggctgctcgaccacattcccggcgctcgcgcccgcgctgaacgtggcgagctcgcc
gcaggcaccatcgacagctggctggtgtggaacctgagcggcggcgtgacccacctcacc
gatgtcagcaatgccagccgcaccctgctgtgcaatctccacaccggcgactgggacgac
gagttgctggcgctgctgcgcgtgccccgcgccgtgctgcctgccatcgtgcccaactgt
ggcgcgctagccgtggcacgtctgggcggtctgaacattcccatcaccggcatggccggc
gaccagcaggccgcgctgtttggccaggcctgtctgcagcccggcatggcgaaaaacacc
tacggcaccggctgcttcgcactgcagcacaccggcacgcaggcggtgcgctcacaacag
cgcctgctgaccaccattgcctggaagctcggcgacgatcagcccttgcattacgctctg
gaaggcggcgtgttcatcgccggggccgcggtgcaatggttgcgcgacggcctcggcttg
gtgcacagcgcgcaagaagcgcagcaactcgccgacagtgtgccagacagcggcggcgtg
ctgctcgtgcccgccttcaccggcctgggcgcgccgcactgggacgcacaggcgcgcggc
ctgctcatcggcatcacccgcggtaccacggcagcgcaggtcgcccgcgccaccatcgac
agcctggcttatcaaagcgccgagctgttcgccgccatgcaggccgacgtcgccgcgcag
ggcgggccgccgctgaccgaactacgggtggatggcggcgcggcggtaaacgacacgctg
atgcagtttcaggccgacctgctgggcgtgcccgtggtgcgccccgtgcaggccgagagc
acggcgctgggcgcggcctatctggccgggctgggcgcagggctgtggccgaacgcggct
gcgctgcccgcgctatggcaggaacaacgccgattcaccccgcaaatgagcaccgacgag
cgcaaggcgcgcatggctcgctggcgtcgcgcggtggagcgcgcccgcgactgggccgac
gactga

DBGET integrated database retrieval system