KEGG   Thiomonas arsenitoxydans: THI_0964Help
Entry
THI_0964          CDS       T02347                                 

Definition
(GenBank) Putative Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00010  Glycolysis / Gluconeogenesis
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THI_0964
Enzymes [BR:thi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     THI_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAZ87665
UniProt: D6CSD7
Position
964290..965192
Genome map
AA seq 300 aa AA seqDB search
MHSLDSLSRFSIPGQLRFHAHPTGLIFAEIDHAAGVASLCLQGAHLTSFRPKSQPEPVVW
VSEAARYLPGKSIRGGVPVCWPWFGPHASESSFPAHGFARTVPWAVVDSGASQGATHLTL
QLQPSDATRAQWPHDTPVSLRIRVSEVLEMDLITHNATAQPLPLSEALHTYFQVGDIAEV
QLLGLDGCSYLDKTEAFARKQQQGAVRFAAETDRVYVDTSAECVIVDPLLQRRIRIAKQG
SASTVVWTPWEQKAAAMGDFTAQGWRNMLCVESANAADNALTLQPGETHTLSVRYSAEAL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcctcgactcgctcagccgtttttccatccccggtcaacttcggttccatgcc
catccaaccgggctgattttcgctgaaatcgaccatgccgcaggcgtggccagcctctgt
ctgcagggcgctcacctcaccagctttcgccccaagtcgcagccggagccggtggtgtgg
gtgtctgaagcggcgcgctatctgccgggcaagtccattcgtggcggcgtgccggtgtgc
tggccctggttcgggccgcacgccagcgagagcagttttccggcgcacggctttgcccgc
accgtgccctgggcggtggtggacagcggggcatcgcaaggcgcgacgcacctcacgctg
caactgcagccctcagacgccacccgcgcgcaatggccgcatgacacgccggtttccctg
cgcatccgcgtgtcggaggtgttggagatggacctgatcacgcacaacgccaccgcgcaa
ccgctgccgctcagcgaggcgctgcacacttatttccaggtcggcgatattgccgaggtg
caattgctggggctcgatggctgcagctacctcgacaagaccgaggccttcgcccgcaag
cagcaacagggcgcggtgcgcttcgccgccgaaaccgaccgggtgtatgtggacacatca
gcggagtgcgtcatcgtcgatccgctgctgcagcggcgcattcgcattgccaagcaggga
tcggcgtccaccgtggtctggacgccgtgggagcagaaagccgccgccatgggcgacttc
accgcgcagggctggcgcaacatgctgtgcgtggagtcggccaacgcggcagacaacgcg
cttaccttgcagcccggcgaaacccacaccctgagcgtgcgctacagcgccgaagcgctg
tga

DBGET integrated database retrieval system