KEGG   Thiomonas arsenitoxydans: THI_1045Help
Entry
THI_1045          CDS       T02347                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta chain (SCS-beta)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00020  Citrate cycle (TCA cycle)
thi00640  Propanoate metabolism
thi00660  C5-Branched dibasic acid metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
thi01200  Carbon metabolism
Module
thi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THI_1045 (sucC)
   00640 Propanoate metabolism
    THI_1045 (sucC)
   00660 C5-Branched dibasic acid metabolism
    THI_1045 (sucC)
Enzymes [BR:thi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     THI_1045 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAZ87743
UniProt: D6CKZ0
Position
1037434..1038597
Genome map
AA seq 387 aa AA seqDB search
MKIHEYQAKQLLREHGVPVPRGKPAFSVDEAVAAAQELGGPVWMVKAQIHAGGRGKGGGV
KLARTLDEVRQLSLQILGMQLVTHQTGPAGQKVRRLLIEDGADIQKEYYVAVLTDRATQK
VAVMASSEGGMDIEEVAAKTPEKILKVFVDPLVGLQDAQGLELAAGIGIPLASQAQAIDV
FKKLYQCYMDTDASLVEINPLILEGNGQIKALDAKFNIDDNALFRHPEIEALRDLDEEDP
AEVQAHKFDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGGSPANFLDVGGGATTEKVTE
AFKIMLHNPHVKAILVNIFGGIMRCDTIAEGVIAASRTVGLSVPLVVRMKGTNEEIGRKM
LADSGLPIISANTMGEAAQAAVHAAQA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaatatcaggccaagcaactattgagagaacacggtgtgccggtacca
cgcggcaagcccgcgttttccgtcgatgaggccgtcgccgcagcgcaggagttgggtggc
ccggtctggatggtgaaggcgcagattcacgctggcgggcggggcaagggcggcggtgtc
aagctggcgcgaacgctggacgaagtccggcaactatccctgcaaatcctggggatgcag
ctcgtcacccatcaaaccggccctgcggggcagaaagtgcgacggctgctgatcgaggat
ggcgccgatatccaaaaagagtattacgtcgccgtgctcaccgaccgtgccacgcaaaaa
gtggccgtcatggcgtcgagcgaaggcggcatggacatcgaagaggtcgccgccaagacg
ccggagaaaattctcaaggtgtttgtcgatccgctggttggcctgcaggacgcgcaaggt
ctggaactggccgcgggcatcggcattccgctcgcctcgcaggcccaggcgatcgacgtg
ttcaagaagctctaccagtgctatatggacaccgacgcctcgctggtggaaatcaacccg
ctgattctcgaaggcaacggccagatcaaggcgctcgatgccaagttcaacatcgacgac
aacgcactgttccgtcaccccgaaatcgaggcgctgcgcgatctcgatgaggaagacccg
gccgaggtgcaggcgcacaaattcgacctcgcctacatccagctcgacggcaatatcggc
tgcctggtcaacggcgccgggctggcgatggcgacgatggacaccatcaagctgttcggc
ggctcgcccgccaactttctcgatgtgggcggcggcgccaccaccgaaaaggtgaccgag
gcgttcaagatcatgctgcacaacccgcatgtcaaggcgattctggtcaacatcttcggc
ggcatcatgcgctgcgacaccattgccgaaggcgtgattgccgcctcgcgcaccgtgggc
ctgagcgtgccgctggtggtgcgcatgaaaggcaccaatgaggagatcgggcgcaagatg
ctggccgactccggcctgcccatcatcagcgccaacaccatgggcgaggcggcgcaagcc
gccgttcatgccgcgcaggcctga

DBGET integrated database retrieval system