KEGG   Thiomonas sp. 3As: THI_1111Help
Entry
THI_1111          CDS       T02347                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
thi  Thiomonas sp. 3As
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:thi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:thi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1096989..1098281
Genome map
AA seq 430 aa AA seqDB search
MDKLRITGQRTLQGVVQASGAKNAALPLIAAALLTAETVQLNNAPQLMDVRTLAKLLRSL
GAQVEQDGGQIRLSAAAVNHYEASYELVKTMRASVLVLGPLLARFGQARVSLPGGCAIGA
RPVDQHIKGLQALGADIAVEHGYIVARVATPSGRLRGARITTDMVTVTGTENLMMAATLA
EGETLIDNAAREPEIVDLANLLRAMGAQIRGDGTSQIRIQGVDALHGASHRIIPDRIEVG
TFLCAALAARGDVTVQGAEPAHQDALLDKLREAGAQIDTGADWVRLRADALPGGRPRAVS
VRTTEYPGFATDMQAQFMAVNCLADGAARMTETIFENRFMHVQELMRLGAQIDIDGHTCV
VHGVPQLSGATVMATDLRASAGLVVAALAAEGETVIDRIYHLDRGYDAMEVKLRGLGAQI
ERISDRISGK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactcagaatcaccgggcagcgcacgctgcaaggcgtggtgcaggccagcggg
gcgaagaacgccgcgctgccgctgattgccgccgcgctgctcaccgccgagacggtgcag
ttgaacaacgcaccgcagctcatggatgtgcgtaccctggccaagctgctgcgcagcctg
ggcgctcaggtcgaacaggacggcgggcagatccgcctcagtgccgcagcggtgaatcac
tacgaggcgtcgtatgagctggtcaagaccatgcgcgcctcggtgctggtgctcgggccc
ttgctggcgcgattcgggcaggcgcgggtgagcctgcccggaggttgcgccatcggcgca
cgcccggttgatcagcacatcaagggcttgcaggcgctgggggcggacatcgcggtggaa
catggctatatcgtggcccgcgtggcgacgccttccggccggttgcgcggcgcgcgcatc
accaccgacatggtcaccgtgacgggcaccgaaaacctgatgatggccgccacgctggcc
gagggcgaaaccctgatcgacaacgcggcgcgcgagcccgagattgtcgatctcgccaat
ttgctgcgtgccatgggcgcgcaaatccgcggcgacggcacctcgcagattcgcattcag
ggcgtggacgccttgcacggcgcgtcgcaccgcatcattcccgaccgcatcgaagtcggc
acttttctgtgcgccgccttggccgcgcgcggcgatgtgacggtgcagggggccgagcct
gcacaccaggacgccttgctcgacaagcttcgcgaagccggagcccagatcgacaccggc
gccgactgggttcgcctgcgggccgatgcgctgcccggcggtcgtccgcgcgccgtctcg
gtgcgcacgaccgaataccccggctttgccaccgatatgcaggcgcagttcatggcggtc
aactgcctggcagacggcgctgcgcgcatgacagaaaccattttcgagaatcgctttatg
catgtgcaggagctcatgcggctgggtgcgcagatcgatatcgacggtcacacctgcgtg
gtgcatggcgtgccgcagctctctggtgccaccgtcatggcgaccgaccttcgcgcctcg
gccggcctggtggtggcggcgctggcggctgaaggcgaaaccgtgatcgaccgcatctat
cacctcgaccgcggctatgacgccatggaggtcaagctgcgcggcctgggcgcgcagatc
gaacgtatcagcgaccgcatcagcggcaagtaa

DBGET integrated database retrieval system