KEGG   Thiomonas arsenitoxydans: THI_1113Help
Entry
THI_1113          CDS       T02347                                 

Definition
(GenBank) putative Histidinol dehydrogenase (HDH) HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00340  Histidine metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    THI_1113
Enzymes [BR:thi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     THI_1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAZ87808
UniProt: D6CL55
Position
1098956..1100293
Genome map
AA seq 445 aa AA seqDB search
MNAPLNAPIHALQLRRLDATGPDFETQYRALFARMADENAEIDARAADILRDVQQRGDAA
VLDFTRKFDRLDAPDMAALEISQAELQAALAAITAEQRSALEAAAIRVRRYHERQLQQVG
QSWEYRDEDGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVQEIIMVVPTP
GGERNPLVLAAAAVAGVSRAFAIGGAQAVGALAYGTATVPAVDKIVGPGNAYVAAAKRRV
FGVCGIDMIAGPSEILVLADGSTPPDWVAMDLFSQAEHDELAQSILLCPDSAYIDAVSEA
IHRLLPDMPRKDIITASLNGRGALIRVRDMAQACELANRIAPEHLEISAQNPHQYVPALK
HAGALFLGAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFIKRSSIIEVSAEGAQQL
GRIASVLAHGERLTAHARAAEMRLR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccccgctcaatgccccgatccatgctttgcaactgcgcaggctagacgccacc
ggccccgacttcgagacgcaataccgcgccctgttcgcgcgcatggccgatgaaaacgcc
gagatcgatgcccgcgcggccgacatcctgcgcgatgtgcaacagcgtggcgatgccgcc
gtgctcgatttcacccgcaagttcgaccgcctcgacgcgcccgacatggccgcgctcgag
atcagccaggccgagctacaggccgcgcttgccgccatcactgcggagcagcgcagcgcg
ttggaggcggccgccatccgggtgcgccgctaccacgagcgccagttgcagcaagtcggc
cagagctgggagtaccgcgatgaagacggcactctgctgggccagaaggtcaccccactc
gaccgcgtgggcatctatgtgccgggcggcaaggcggcctatccctcttcggtactgatg
aacgccattccggcgcatgtggcgggtgtgcaagagatcatcatggtcgtgcccacgccg
ggcggcgagcgcaatccgctggtgctggccgcagcggccgtggccggcgtgagccgggcc
ttcgccatcggcggggcgcaggcggtgggcgctctggcttacggcacggccaccgtgccc
gcggtggacaaaatcgtcggccctggcaacgcctatgtggccgcggccaagcggcgggtg
ttcggcgtttgcggcatcgacatgatcgccgggccgtccgagattctggtgctcgccgac
ggcagcacgccgcccgactgggtggcgatggatctgttcagccaggccgagcatgacgaa
ctggcgcagagcatcctgctctgtcctgattcggcctatatcgacgccgtgtccgaggcc
atccaccggctgctgcccgacatgccgcgcaaggacatcatcaccgcctcgctgaacggc
cgcggtgcgctcatccgcgtgcgcgacatggcgcaggcttgcgaactggccaaccgtatc
gcgccggaacacctggagatttccgcgcagaacccgcatcaatatgtgcccgcgctcaag
cacgctggcgcgctgtttctcggcgcctacacctccgagtcgctcggcgactactgcgcc
gggcccaaccatgtcttgcccacttcgggcacggcccggttctcctcgccgctgggggtg
tacgacttcatcaagcgctccagcatcatcgaggtcagcgccgagggcgcgcagcaactc
ggccgtatcgccagcgtgctggcccacggcgaacgcctgaccgcgcacgcccgcgccgcc
gaaatgcggctgcgctga

DBGET integrated database retrieval system