KEGG   Thiomonas sp. 3As: THI_1113Help
Entry
THI_1113          CDS       T02347                                 

Definition
putative Histidinol dehydrogenase (HDH) HisD (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
thi  Thiomonas sp. 3As
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:thi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:thi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098956..1100293
Genome map
AA seq 445 aa AA seqDB search
MNAPLNAPIHALQLRRLDATGPDFETQYRALFARMADENAEIDARAADILRDVQQRGDAA
VLDFTRKFDRLDAPDMAALEISQAELQAALAAITAEQRSALEAAAIRVRRYHERQLQQVG
QSWEYRDEDGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVQEIIMVVPTP
GGERNPLVLAAAAVAGVSRAFAIGGAQAVGALAYGTATVPAVDKIVGPGNAYVAAAKRRV
FGVCGIDMIAGPSEILVLADGSTPPDWVAMDLFSQAEHDELAQSILLCPDSAYIDAVSEA
IHRLLPDMPRKDIITASLNGRGALIRVRDMAQACELANRIAPEHLEISAQNPHQYVPALK
HAGALFLGAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFIKRSSIIEVSAEGAQQL
GRIASVLAHGERLTAHARAAEMRLR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccccgctcaatgccccgatccatgctttgcaactgcgcaggctagacgccacc
ggccccgacttcgagacgcaataccgcgccctgttcgcgcgcatggccgatgaaaacgcc
gagatcgatgcccgcgcggccgacatcctgcgcgatgtgcaacagcgtggcgatgccgcc
gtgctcgatttcacccgcaagttcgaccgcctcgacgcgcccgacatggccgcgctcgag
atcagccaggccgagctacaggccgcgcttgccgccatcactgcggagcagcgcagcgcg
ttggaggcggccgccatccgggtgcgccgctaccacgagcgccagttgcagcaagtcggc
cagagctgggagtaccgcgatgaagacggcactctgctgggccagaaggtcaccccactc
gaccgcgtgggcatctatgtgccgggcggcaaggcggcctatccctcttcggtactgatg
aacgccattccggcgcatgtggcgggtgtgcaagagatcatcatggtcgtgcccacgccg
ggcggcgagcgcaatccgctggtgctggccgcagcggccgtggccggcgtgagccgggcc
ttcgccatcggcggggcgcaggcggtgggcgctctggcttacggcacggccaccgtgccc
gcggtggacaaaatcgtcggccctggcaacgcctatgtggccgcggccaagcggcgggtg
ttcggcgtttgcggcatcgacatgatcgccgggccgtccgagattctggtgctcgccgac
ggcagcacgccgcccgactgggtggcgatggatctgttcagccaggccgagcatgacgaa
ctggcgcagagcatcctgctctgtcctgattcggcctatatcgacgccgtgtccgaggcc
atccaccggctgctgcccgacatgccgcgcaaggacatcatcaccgcctcgctgaacggc
cgcggtgcgctcatccgcgtgcgcgacatggcgcaggcttgcgaactggccaaccgtatc
gcgccggaacacctggagatttccgcgcagaacccgcatcaatatgtgcccgcgctcaag
cacgctggcgcgctgtttctcggcgcctacacctccgagtcgctcggcgactactgcgcc
gggcccaaccatgtcttgcccacttcgggcacggcccggttctcctcgccgctgggggtg
tacgacttcatcaagcgctccagcatcatcgaggtcagcgccgagggcgcgcagcaactc
ggccgtatcgccagcgtgctggcccacggcgaacgcctgaccgcgcacgcccgcgccgcc
gaaatgcggctgcgctga

DBGET integrated database retrieval system