KEGG   Thiomonas arsenitoxydans: THI_1199Help
Entry
THI_1199          CDS       T02347                                 

Gene name
manB
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THI_1199 (manB)
   00030 Pentose phosphate pathway
    THI_1199 (manB)
   00051 Fructose and mannose metabolism
    THI_1199 (manB)
   00052 Galactose metabolism
    THI_1199 (manB)
   00500 Starch and sucrose metabolism
    THI_1199 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    THI_1199 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    THI_1199 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    THI_1199 (manB)
Enzymes [BR:thi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     THI_1199 (manB)
    5.4.2.8  phosphomannomutase
     THI_1199 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1187487..1188863
Genome map
AA seq 458 aa AA seqDB search
MAQLDPTIFKAYDIRGIVGKTLTEDACRAIGQAFATLARRNGETAVNISRDGRLSGPALA
QALSDGLRAGGVDVIDLGMNATPMLYYACATTPVVSGIQITGSHNPPEYNGLKMVLGGNA
LFGEQIQELLALTRSEAFAQGQGSARQASIVEDYLGRIEGDIKLARPMKVVVDCGNGVSG
AFAPRLLRSLGCEVVELYCEVDGTFPNHHPDPADPRNLEDLIRTVLDTGAELGLAFDGDG
DRLGVVTPSGAVIWPDRQLMLYAADVLERHPGAPILFDVKCTAQLPAWVRRHGGEPVMGR
TGHSLVKAKMKEIDAPLAGEMSGHIFFKDRWYGFDDAQYGAARLLEILSRAENAGAVLEA
LPDSVSTPELKLQTAEGANFTLCERLQREGRFPGASNISTIDGVRADYADGFGLARPSNT
TPCVVLRFEGADAAALARIQAEFRAALLALDASLILPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctcgatcccacgattttcaaggcctacgacattcgcggcatcgttggcaaa
acgctgaccgaggacgcctgccgcgcgatcggccaggccttcgccacgctggcgcggcgc
aatggcgagacggcggtgaatatcagccgcgacgggcgtctatccggcccggcgctggcg
caggcgcttagcgacggtttgcgcgccgggggcgtggacgtgatcgatctgggcatgaac
gccacgcccatgctgtattacgcctgcgccaccacgccggtggtcagcggcattcagatc
accggcagccacaatccgcccgagtacaacggtctgaaaatggtgctcggcggcaatgcc
ctgttcggcgagcagattcaggaattgctcgcgctgacccgcagcgaagccttcgcacaa
ggacaaggtagcgcgcggcaggcctccatcgtcgaggactatctgggccgcatcgaaggc
gacatcaagctggcgcggccgatgaaagtggtggtcgattgcggcaacggcgtttcaggc
gcttttgcgccgcgcttgctgcgcagcctgggctgcgaggtggtggagttgtactgcgaa
gtcgatggcacctttcccaaccatcatcccgaccccgccgatccgcgcaacctcgaagat
ctcatccgcaccgtgctcgacaccggcgccgaactggggctggcgtttgatggcgacggc
gaccgtctcggcgtggtcacgcccagtggggccgtcatctggcccgatcgccagctcatg
ctctacgccgccgatgtgctggagcgccatcccggcgcgcccattctgttcgacgtgaaa
tgcaccgcgcagctgcccgcctgggtgcgtcggcatggcggcgagccggtgatgggccgc
accgggcattcgctggtcaaggccaagatgaaagaaatcgacgcgccgctggctggcgag
atgagcggccacatctttttcaaggatcgctggtacggcttcgacgacgcgcagtatggt
gcggcgcggctgctggaaattctttctcgtgccgagaatgcgggggccgtgctcgaagcc
ctgcccgattccgtctccaccccggagctgaagctgcagacggccgagggcgccaacttc
acgctgtgcgagcgtttgcagcgagagggccgctttcccggcgcttcgaatatttccacc
atcgacggcgtgcgtgccgactacgccgatggcttcggcttggcgcggccctccaacacg
acgccctgcgtggtgctgcgattcgagggcgctgatgcagcggcgctggcgcggattcag
gccgagttccgcgccgcgttgctggcgctcgatgcttcgttgatactgccattttga

DBGET integrated database retrieval system