KEGG   Thiomonas arsenitoxydans: THI_1199Help
Entry
THI_1199          CDS       T02347                                 

Gene name
manB
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00010  Glycolysis / Gluconeogenesis
thi00030  Pentose phosphate pathway
thi00051  Fructose and mannose metabolism
thi00052  Galactose metabolism
thi00230  Purine metabolism
thi00500  Starch and sucrose metabolism
thi00520  Amino sugar and nucleotide sugar metabolism
thi00521  Streptomycin biosynthesis
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THI_1199 (manB)
   00030 Pentose phosphate pathway
    THI_1199 (manB)
   00051 Fructose and mannose metabolism
    THI_1199 (manB)
   00052 Galactose metabolism
    THI_1199 (manB)
   00500 Starch and sucrose metabolism
    THI_1199 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    THI_1199 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    THI_1199 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    THI_1199 (manB)
Enzymes [BR:thi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     THI_1199 (manB)
    5.4.2.8  phosphomannomutase
     THI_1199 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAZ87892
UniProt: D6CPG2
Position
1187487..1188863
Genome map
AA seq 458 aa AA seqDB search
MAQLDPTIFKAYDIRGIVGKTLTEDACRAIGQAFATLARRNGETAVNISRDGRLSGPALA
QALSDGLRAGGVDVIDLGMNATPMLYYACATTPVVSGIQITGSHNPPEYNGLKMVLGGNA
LFGEQIQELLALTRSEAFAQGQGSARQASIVEDYLGRIEGDIKLARPMKVVVDCGNGVSG
AFAPRLLRSLGCEVVELYCEVDGTFPNHHPDPADPRNLEDLIRTVLDTGAELGLAFDGDG
DRLGVVTPSGAVIWPDRQLMLYAADVLERHPGAPILFDVKCTAQLPAWVRRHGGEPVMGR
TGHSLVKAKMKEIDAPLAGEMSGHIFFKDRWYGFDDAQYGAARLLEILSRAENAGAVLEA
LPDSVSTPELKLQTAEGANFTLCERLQREGRFPGASNISTIDGVRADYADGFGLARPSNT
TPCVVLRFEGADAAALARIQAEFRAALLALDASLILPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctcgatcccacgattttcaaggcctacgacattcgcggcatcgttggcaaa
acgctgaccgaggacgcctgccgcgcgatcggccaggccttcgccacgctggcgcggcgc
aatggcgagacggcggtgaatatcagccgcgacgggcgtctatccggcccggcgctggcg
caggcgcttagcgacggtttgcgcgccgggggcgtggacgtgatcgatctgggcatgaac
gccacgcccatgctgtattacgcctgcgccaccacgccggtggtcagcggcattcagatc
accggcagccacaatccgcccgagtacaacggtctgaaaatggtgctcggcggcaatgcc
ctgttcggcgagcagattcaggaattgctcgcgctgacccgcagcgaagccttcgcacaa
ggacaaggtagcgcgcggcaggcctccatcgtcgaggactatctgggccgcatcgaaggc
gacatcaagctggcgcggccgatgaaagtggtggtcgattgcggcaacggcgtttcaggc
gcttttgcgccgcgcttgctgcgcagcctgggctgcgaggtggtggagttgtactgcgaa
gtcgatggcacctttcccaaccatcatcccgaccccgccgatccgcgcaacctcgaagat
ctcatccgcaccgtgctcgacaccggcgccgaactggggctggcgtttgatggcgacggc
gaccgtctcggcgtggtcacgcccagtggggccgtcatctggcccgatcgccagctcatg
ctctacgccgccgatgtgctggagcgccatcccggcgcgcccattctgttcgacgtgaaa
tgcaccgcgcagctgcccgcctgggtgcgtcggcatggcggcgagccggtgatgggccgc
accgggcattcgctggtcaaggccaagatgaaagaaatcgacgcgccgctggctggcgag
atgagcggccacatctttttcaaggatcgctggtacggcttcgacgacgcgcagtatggt
gcggcgcggctgctggaaattctttctcgtgccgagaatgcgggggccgtgctcgaagcc
ctgcccgattccgtctccaccccggagctgaagctgcagacggccgagggcgccaacttc
acgctgtgcgagcgtttgcagcgagagggccgctttcccggcgcttcgaatatttccacc
atcgacggcgtgcgtgccgactacgccgatggcttcggcttggcgcggccctccaacacg
acgccctgcgtggtgctgcgattcgagggcgctgatgcagcggcgctggcgcggattcag
gccgagttccgcgccgcgttgctggcgctcgatgcttcgttgatactgccattttga

DBGET integrated database retrieval system