KEGG   Thiomonas arsenitoxydans: THI_1203Help
Entry
THI_1203          CDS       T02347                                 

Definition
(GenBank) putative Protein-L-isoaspartate (D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
thi  Thiomonas arsenitoxydans
Brite
Enzymes [BR:thi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     THI_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 RrnaAD MTS PrmA Methyltransf_18 Methyltransf_12 Methyltransf_23 Methyltr_RsmB-F MetW GCD14 Ubie_methyltran Cons_hypoth95 Methyltransf_4 Methyltransf_32 CMAS UPF0020 DUF938
Motif
Other DBs
NCBI-ProteinID: CAZ87896
UniProt: D6CPG6
Position
complement(1191740..1192390)
Genome map
AA seq 216 aa AA seqDB search
MSIEQARFNMIEQQIRPWNVLDAGILELLGSVRREDFVPAAYRGLAFMDTEIPLPCGQNM
LAPKVEARILQELAVRKDEWVLEIGAGSGFMAALLGHRAAAVQTLEIHEELVTMARANLQ
RAGMNNVTVEQADGAHYAKSAEFDVIVLSGSVAQIPQDLLQRLKPGGRLAAIVGDEPVMR
AQIVTRATATDFRTRDLFDTVATRLEHFPEPSRFQF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgagcaagcccgtttcaacatgatcgagcagcagatccgtccctggaatgtg
ctggacgccggcatcctcgaactgctgggcagcgtgcgccgcgaagacttcgtgcccgcg
gcctatcgcggtctggccttcatggacaccgaaattcccctgccctgcggccagaacatg
ctcgcccccaaggtagaggcgcgcatcctgcaagaactcgcggtgcgcaaggatgaatgg
gtgctcgaaatcggcgcgggcagcggcttcatggccgcgctgctcggccaccgcgccgct
gcggtgcagaccctggaaattcatgaagaactggtgaccatggcgcgcgccaacctgcag
cgcgccggcatgaacaacgtcaccgtcgagcaggccgatggcgcgcactacgccaaaagc
gccgaattcgatgtgatcgtgctctccggctcggtcgcgcaaattccgcaagacctgctg
caacgcctcaaaccgggcgggcggctggcggccatcgtcggcgacgaacccgtgatgcgc
gcgcagatcgtcacccgcgccaccgccaccgacttccgcacccgcgatctgttcgatacc
gtggccacgcggctggagcatttccccgagccgtcgcgcttccaattctga

DBGET integrated database retrieval system