KEGG   Thiomonas arsenitoxydans: THI_1225Help
Entry
THI_1225          CDS       T02347                                 

Definition
putative Metallo-dependent phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THI_1225
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    THI_1225
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    THI_1225
Enzymes [BR:thi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     THI_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1210649..1212061)
Genome map
AA seq 470 aa AA seqDB search
MGAAPKTALIPPTRRAFLRGGLVTSALLATGQWPFPAAWAEPAAPGVLYAGPMQGYVAAR
SALIWVQTPGAAEVALEYAPENQPGEKKRSASVRTDAAGQFCAHLVMDDLSPGTRYRAVA
WVNGKPAANRTLVVRTQPIWQFRSPPPDVTLLTGSCAYLNDPLFDRPGQPYGGGYEIYEP
MTQEGADLMVWLGDNLYYREVDCQSPQGMALRYRQQRGFAPLDAFLRSTPQVAIWDDHDY
GPNDSDASFEFKNASLDLFKTYWANPTYGVGDVAGVFTKTSIADADIFLLDDRWWRSADA
TSPGDRGKVMFGPAQMRWLRNALLFSRARFKIVAAGGQFFNDDDAYEGWNQFPEERAAFL
GWLQQYRIPGLLFLSGDRHITELIRYPRPAYGGKRDYPLVEFTCSPLNSGPAKGDGNPNR
VPGTLVAERNYGVLKFSGEGKERRLELQAKNVGGKLLWSHTLALADLGWG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcgccgaagaccgcgttgatccctccgacccgccgcgcattcttgcggggc
ggtctggtgacttccgcgctgctggccaccgggcaatggccctttcctgcagcctgggct
gaaccagccgcccccggcgtgctctacgccgggccgatgcagggctatgtggctgcacgc
tctgccctcatctgggtgcagacgcccggcgcagccgaagtggcgttggagtatgcccca
gagaatcagcccggcgagaaaaagcgctccgcgtcggttcgcaccgatgcggcagggcag
ttctgcgctcatctggtcatggacgatctctctcccggcacgcgctaccgtgctgtggcc
tgggtcaatggcaaaccggctgcgaatcgcaccctcgtcgtgcgcacgcagcccatctgg
cagtttcgttcaccgccgcccgatgtcaccctcctgacgggttcttgcgcatatctgaac
gacccgctgttcgaccggccgggccagccctatggcggcggctacgaaatttatgagccg
atgacgcaggaaggcgccgatctgatggtgtggctgggcgacaacctctattaccgcgag
gtggattgtcagagcccgcaaggcatggcgctgcgctaccgccaacagcgcggcttcgct
ccgctggatgcgtttttacgctcaaccccgcaagtggcgatctgggacgaccatgattac
ggcccgaacgacagcgatgcgagtttcgagttcaagaacgcctcgctcgatctgttcaaa
acctattgggccaacccgacgtatggcgttggcgacgtcgccggagtgttcactaagacc
agcatcgccgatgccgatatttttctgctcgatgatcgttggtggcgcagcgcagacgcc
accagcccaggtgaccgcggcaaggtgatgttcggcccggcgcagatgcgctggctgcgc
aacgccctgctgttctcgcgcgcccgcttcaagatcgtcgccgccggcggccagtttttc
aacgacgacgacgcttacgagggctggaaccagtttcccgaagaacgcgccgcatttctc
ggctggctgcagcaataccgcatccccggcttgttgtttctctcgggagaccggcacatc
accgagctgatccggtatccgcgcccggcctacggcggcaagcgcgactatccgctggtg
gagttcacctgctcaccgctgaattccgggccggccaaaggcgacggcaatcccaaccgc
gtacccggcacgctagtcgctgagcgcaactacggcgtgctcaaattcagcggcgagggc
aaggagcggcggctggagctgcaagccaagaacgtcggcggcaagctgctgtggtcgcac
accctggcgctggccgacctgggctggggctag

DBGET integrated database retrieval system