KEGG   Thiomonas sp. 3As: THI_1389Help
Entry
THI_1389          CDS       T02347                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
thi  Thiomonas sp. 3As
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:thi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1376967..1379162)
Genome map
AA seq 731 aa AA seqDB search
MLTEHDIADLAAGHHADPFGVLGMHLRGATLWVNAVLPGALGVEVIERTSGESVAALERQ
HETAVFSARMGHRRKPFDYVLRVTWPPLQPGDPNWVTDLEDPYRFPQVLGETDAWLLAEG
THLRPYECLGAHPGEMLGVAGTRFAVWAPNARRVSVIGDFNGWDGRRHPMRLRRECGVWE
IFLPGVSQGALYKFEILTQHGELLQKADPMAFRAELRPNTASIVQGLPPLHPIRPGMAQA
NGFEAPISIYEVHLGSWRKVEGWRWLSYRELAETLVPYARDLGFTHLELLPVSEHPFDGS
WGYQPISLYAPTARFGTPEDFQFLVDAAHEAGLGVILDWVPAHFPSDPHGLANFDGTHLY
EYADPKEGFHHDWNTLIYNFGRTEVRNYLVANALYWLERFNIDGLRVDAVASMLYRDYSR
PAGQWVPNKFGGRENLEAIDFLRRMNHTVGVQRPGAITLAEESTAFPGVSRPPSDDLQSG
GLGFHYKWNMGWMHDSLSYIRRDPVHRKYHHNELTFSMMYAYDENFVLPLSHDEVVHGKG
SLLAKMPGDRWQQFANLRAYLGYMFSHPGKKLLFMGDEFAQASEWQSDYSLDWDALLHAP
NQGVQRLVRDLNLTYRAHPALHQLDHHPGGFAWITYDDASQSVLAYERGASEGSRFVVLC
NFTPTPRHDYRIGVPQGGRWEALINTDDAVYDGSGLSLALREAEAQPSHGRPFSLQLTLP
PLACVILRPAA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgaacacgacatcgccgacctcgccgcaggccaccacgccgacccttttggc
gtgctcggcatgcatttgcgcggcgccacgctgtgggtgaatgccgtactgcccggcgcg
ctgggcgtggaggtgatcgagcgcaccagcggcgaatcggtcgccgcgctggagcggcag
cacgagaccgcggtattcagcgcccgcatgggccaccgccgcaagcccttcgactatgtg
ctgcgggtgacctggccgcccttgcagccgggcgatccgaactgggtgaccgacctcgaa
gacccctaccgctttccgcaagtgctgggcgagaccgacgcctggctgctggccgaaggc
acccatctgcgtccctacgaatgtctgggcgcgcatccgggcgagatgctcggcgtggct
ggcacacgctttgcggtgtgggcgcccaacgcgcggcgcgtttcggtgatcggcgatttc
aacggctgggacggccgccgccaccccatgcggctgcggcgcgaatgcggcgtgtgggaa
atcttcctccccggcgtgagccagggcgcgctttacaaattcgagatcctcacccagcac
ggcgaactgctgcaaaaggccgatccgatggccttccgcgccgaactgcgacccaacacc
gccagcatcgtgcagggcctgccgcccctgcaccccatccgccccggcatggcgcaggcc
aatggcttcgaggcacccatcagcatttacgaggtgcatctgggctcgtggcgcaaggtg
gagggctggcgctggctgagctaccgcgaactggccgaaaccctggtgccctatgcccgc
gacctgggcttcacccatctggagctgctgccggtcagcgaacatcccttcgacggctcc
tggggctatcagcccatcagcctgtatgcgcccaccgcgcgcttcggcacgcccgaagac
tttcagtttttggtcgatgccgcgcacgaagccggactgggcgtgattctcgactgggtg
ccggcacactttccatccgacccgcatggcctggccaacttcgacggcacacatctgtac
gaatacgccgacccgaaagagggcttccaccacgactggaacaccctgatctacaacttc
ggccgcaccgaagtacgcaactatctggtggccaacgccctgtactggctggagcgcttc
aacatcgacggcctgcgcgtggacgccgtagcctccatgctctaccgcgactacagccgc
ccggccggtcagtgggtgcccaacaagttcggcggacgtgagaacctcgaagccatcgac
tttctgcgccgcatgaaccacaccgtcggcgtgcagcggccgggcgccataaccctcgcg
gaagagtccaccgcctttcccggcgtcagccgcccgccgagcgacgacctgcaaagcggc
ggcctgggctttcactacaagtggaatatgggctggatgcacgacagcctgagctacatc
cgccgagacccggtgcaccgcaagtaccaccacaacgagctgaccttcagcatgatgtac
gcctatgacgagaacttcgtgctgccgctctcgcacgacgaagtggtgcatggcaaaggc
tcgctgctcgccaagatgcccggcgaccgctggcaacagttcgccaacctgcgcgcctat
ctcggctatatgttcagtcatcctggcaagaagctgctgttcatgggcgacgaattcgcg
caggcttcggaatggcagtccgactacagcctcgactgggacgcgctgctgcacgcgccc
aaccagggcgtgcaacgtctggtgcgcgacctcaacctcacctaccgcgcccacccggcg
ctgcatcagctcgaccatcacccgggcggcttcgcctggatcacctatgacgacgcttcg
caatcggtgctggcctacgagcgcggtgccagcgagggcagccgcttcgtcgtgctgtgc
aacttcacccccaccccgcgtcacgactaccgcatcggcgtgccgcaaggcgggcgctgg
gaggcgctgatcaataccgacgatgccgtgtacgacggctccggcctgtcgctggccctg
cgcgaagccgaggcccagccctcgcatggccgcccgttctcgctgcaactcaccctgccg
ccgctggcttgcgtcattctgcggcccgccgcctga

DBGET integrated database retrieval system