KEGG   Thiomonas sp. 3As: THI_1390Help
Entry
THI_1390          CDS       T02347                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (Amylomaltase) (Disproportionating enzyme) (D-enzyme) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
thi  Thiomonas sp. 3As
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:thi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1379177..1380691)
Genome map
AA seq 504 aa AA seqDB search
MTPTPRFPRSSGVLLHLTSLPSPHGSGDLGPAAYHFIDWLHAAGQSVWQFLPLGGIGLGG
SPYMSSSAFAGNVLLIDLTELHRRGWLEADDLVAQEGLSDERVQFDRVIPYRMERLRRAA
ARFETTATPQERADLAAFQTKHAVWLNDYALFMALSEHYGERLWNTWDAALAQRQPEALQ
QARARHAERVAFWTFAQWCFFRQWAALRAYAHDKGVRLMGDMPIFISLNSADVWARPDLF
QLDASGNPTVVAGVPPDYFSATGQRWGNPHYRWAAHEAEGFAWWIARLRATFELVDWVRV
DHFRGFESCWEIPADEPTAIGGRWVQTPGVALFEAVSKALGPLPIIAEDLGVITPEVTAL
RQRFGFPGMRILHFAWGQNDGGDNAYLPHNYTHDTVVYPGTHDNDTSQGWWATAPEAVRH
HLREYLACDGGDIAWTLIRAASASVADIALFALQDVLRLDGTQRMNTPGTAQGNWTWRFT
WDQVQPGHAAGLLRFGQLYNRLPA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccaccccccgttttccccgctccagcggcgtgctgctgcacctcaccagtctg
cccagcccgcacggcagcggcgatctcgggcccgcggcctaccacttcatcgactggctg
catgccgccggacaatcggtctggcaattcctgccgctgggcggcatcggcctgggcggc
tcgccctatatgagcagttcggccttcgccggcaatgtgctgctgatcgacctcaccgag
ctgcaccggcgcggctggctggaagccgacgatctcgtcgcgcaagagggactgtcggac
gagcgcgtgcagttcgaccgcgtcatcccgtatcgcatggaacgtctgcgccgggccgca
gcgcggttcgagacgaccgccacgccgcaggagcgcgccgacctggccgccttccaaacc
aagcacgccgtctggctcaacgactacgcgttgttcatggcgctgtccgagcactacggc
gagcgcttgtggaacacctgggacgccgcgctggcgcaacgtcagcccgaagcgctgcag
caagcacgggcgcggcacgccgagcgcgtcgccttctggaccttcgcccaatggtgcttt
ttccgccaatgggccgcgctgcgcgcctacgcccacgacaaaggcgtgcggctgatgggc
gacatgccgattttcatttcgctcaacagcgccgatgtatgggcccggcccgacctgttc
cagctcgacgccagcggcaaccccaccgttgtggccggggtgccgcccgactatttttcc
gccaccggccagcgctggggcaacccgcattaccgctgggcggcgcacgaggccgaaggg
tttgcctggtggatcgcgcggctgcgcgccaccttcgagctggtggactgggtgcgcgtc
gatcatttccgcggtttcgagagctgctgggaaatccccgccgacgagcccacggccatc
ggcggccgctgggtgcagacgccgggcgtggcgctgttcgaggcggtgtccaaagcgctc
gggcccctgcccatcattgccgaagatctgggcgtcatcacccccgaagtcaccgccctg
cgccagcgcttcggctttcccggcatgcgcatcctgcacttcgcctgggggcagaacgat
ggcggcgacaacgcctacctgccgcacaactacacccacgacaccgtggtctatcccggc
acccacgacaacgacacctcgcagggctggtgggcgactgcgcctgaagcggtgcgccac
catctgcgcgaatacctcgcctgcgacggcggcgacatcgcctggacgctgatccgcgcc
gccagcgccagcgtggccgacatcgccctgttcgccttgcaggacgtgctgcgtctggat
ggcacgcagcgcatgaacacaccgggcacggcgcaaggcaactggacctggcgcttcacc
tgggatcaggtacaaccggggcatgcagctggcctgctgcgtttcggccagctctacaac
cgtctccccgcctga

DBGET integrated database retrieval system