KEGG   Thiomonas sp. 3As: THI_1495Help
Entry
THI_1495          CDS       T02347                                 

Definition
putative GGDEF family protein, diguanylate cyclase domain (EC:2.7.7.65)
Orthology
K13590  
diguanylate cyclase
Organism
thi  Thiomonas sp. 3As
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1471374..1473014
Genome map
AA seq 546 aa AA seqDB search
MPTISDQARATLKRLLELKLQPTPDNYRRVFESLQKGAALPSAEPSLESPDWGRALPRLL
EQWERSQSGLTQLQKRQQLDRLAALPTPQAQWRELEQLLERWSALPARSGSQSASTPIET
RDDALSRAGSEWRELWLQTLKFGVRPFCAHDTAQRLLRELMAAAENAEQAADLGTQAREV
WLAIDREQSTEEAVRNGLIELARLLLDHLGDLVPQAWVGVQATAIREQLQTPLVPERIES
AQNAVRDLLVRHSVLRKSEDDAHHTAKALIDLLVRKLGDYAAEGGEYNQRMEARLQQLQS
SREWDEIRDLVQDVLDDSRNMQQRSGELGVHLAEAQRQAQAAQERIRSLEGELEQVSQQL
QEDPLTGALNRRGLDAEFTRMQSRVVRQGQPLTLALLDLDHFKAVNDTHGHDTGDAVLKA
LVAQAKRLIRPSDRVARMGGEEFMLLLPDTPVQQSLVVVQRLLVAFSDQTLVQDSTGRRI
PLSFSAGVAELCPDEDFAAIYQRVDAALLQAKQAGRKRVEFAVPCDGAKAGGSLPKSALR
FFALRG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccatttccgaccaggcgcgcgccaccctcaagcgcttgctcgaactcaagctg
cagcccaccccggacaattaccgccgcgtttttgaaagtctgcaaaagggcgcagcgctt
ccgtccgcagagccttcgctggaaagcccggattggggccgtgcgctgccccggctgctg
gagcaatgggagcgctcgcaaagcgggctgacccagttgcaaaaacgccagcagctcgac
cgccttgccgccttgcctacgccgcaggcccagtggcgcgagttggagcaactgctagag
cgctggagtgcgctgcccgcgcgcagcggcagtcagagcgcgtccacccccattgaaacc
cgcgacgacgctttgagccgtgcaggcagcgaatggcgcgagctttggctgcaaaccctc
aaatttggcgtgcgccccttttgcgcgcacgacaccgcgcagcgcctgctgcgcgagttg
atggcggcggcggaaaatgccgaacaggcggccgacctgggcacgcaggcgcgcgaagtc
tggctggccatcgaccgcgagcaatccaccgaagaggcggtgcgcaacggcttgattgaa
ctcgcgcggctgttgctcgatcatctcggcgatctggtgccgcaggcctgggtaggcgtg
caggccacggcgattcgcgagcaattgcagacgccgctggtccccgagcgcatcgaatcg
gcgcagaatgccgtgcgcgatctactggtgcgccacagcgtgctgcgcaagagcgaagac
gacgcgcaccacaccgccaaggcgctgatcgatctgttggtgcgcaagctgggcgactac
gccgctgagggcggcgaatacaaccagcgcatggaagcccggctgcagcaattgcagagc
agccgcgagtgggacgaaatccgcgatctggtgcaggatgtgctcgacgacagccgcaat
atgcagcagcgcagcggcgaactcggcgtgcatctggccgaggcgcagcgccaggcgcag
gcggcgcaagagcgcatccgctcgctcgaaggcgaactagaacaggtcagccagcaattg
caggaagacccgctcaccggcgcgctcaaccgccgcgggctggatgccgagttcacccgt
atgcagtcgcgcgtggtgcgtcagggccagccgctcaccctggcgctgctcgacctcgat
cacttcaaggcggtgaacgacacccacggccacgatactggcgacgccgtgctcaaggcg
ctggtggcgcaggccaaacggctgatccggccgagcgaccgcgtggcgcgcatggggggc
gaggagttcatgctcctcctgcccgacacgccggtgcagcagtcgctcgtcgtggtgcag
cggctgctggttgcgttcagcgatcagaccctggtgcaggacagcacggggcggcgcatt
cccctgagtttcagcgccggggtggccgaactgtgcccggatgaagacttcgccgcgatc
tatcagcgcgtggacgccgcactgctgcaggccaagcaggcggggcgcaaacgggtggaa
ttcgccgtgccctgcgatggtgccaaggccggtggcagcctgcccaagagcgcgctgcga
ttcttcgcgcttcgggggtaa

DBGET integrated database retrieval system