KEGG   Thiomonas arsenitoxydans: THI_1495Help
Entry
THI_1495          CDS       T02347                                 

Definition
(RefSeq) putative GGDEF family protein, diguanylate cyclase domain (EC:2.7.7.65)
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
thi  Thiomonas arsenitoxydans
Brite
Enzymes [BR:thi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     THI_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1471374..1473014
Genome map
AA seq 546 aa AA seqDB search
MPTISDQARATLKRLLELKLQPTPDNYRRVFESLQKGAALPSAEPSLESPDWGRALPRLL
EQWERSQSGLTQLQKRQQLDRLAALPTPQAQWRELEQLLERWSALPARSGSQSASTPIET
RDDALSRAGSEWRELWLQTLKFGVRPFCAHDTAQRLLRELMAAAENAEQAADLGTQAREV
WLAIDREQSTEEAVRNGLIELARLLLDHLGDLVPQAWVGVQATAIREQLQTPLVPERIES
AQNAVRDLLVRHSVLRKSEDDAHHTAKALIDLLVRKLGDYAAEGGEYNQRMEARLQQLQS
SREWDEIRDLVQDVLDDSRNMQQRSGELGVHLAEAQRQAQAAQERIRSLEGELEQVSQQL
QEDPLTGALNRRGLDAEFTRMQSRVVRQGQPLTLALLDLDHFKAVNDTHGHDTGDAVLKA
LVAQAKRLIRPSDRVARMGGEEFMLLLPDTPVQQSLVVVQRLLVAFSDQTLVQDSTGRRI
PLSFSAGVAELCPDEDFAAIYQRVDAALLQAKQAGRKRVEFAVPCDGAKAGGSLPKSALR
FFALRG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccatttccgaccaggcgcgcgccaccctcaagcgcttgctcgaactcaagctg
cagcccaccccggacaattaccgccgcgtttttgaaagtctgcaaaagggcgcagcgctt
ccgtccgcagagccttcgctggaaagcccggattggggccgtgcgctgccccggctgctg
gagcaatgggagcgctcgcaaagcgggctgacccagttgcaaaaacgccagcagctcgac
cgccttgccgccttgcctacgccgcaggcccagtggcgcgagttggagcaactgctagag
cgctggagtgcgctgcccgcgcgcagcggcagtcagagcgcgtccacccccattgaaacc
cgcgacgacgctttgagccgtgcaggcagcgaatggcgcgagctttggctgcaaaccctc
aaatttggcgtgcgccccttttgcgcgcacgacaccgcgcagcgcctgctgcgcgagttg
atggcggcggcggaaaatgccgaacaggcggccgacctgggcacgcaggcgcgcgaagtc
tggctggccatcgaccgcgagcaatccaccgaagaggcggtgcgcaacggcttgattgaa
ctcgcgcggctgttgctcgatcatctcggcgatctggtgccgcaggcctgggtaggcgtg
caggccacggcgattcgcgagcaattgcagacgccgctggtccccgagcgcatcgaatcg
gcgcagaatgccgtgcgcgatctactggtgcgccacagcgtgctgcgcaagagcgaagac
gacgcgcaccacaccgccaaggcgctgatcgatctgttggtgcgcaagctgggcgactac
gccgctgagggcggcgaatacaaccagcgcatggaagcccggctgcagcaattgcagagc
agccgcgagtgggacgaaatccgcgatctggtgcaggatgtgctcgacgacagccgcaat
atgcagcagcgcagcggcgaactcggcgtgcatctggccgaggcgcagcgccaggcgcag
gcggcgcaagagcgcatccgctcgctcgaaggcgaactagaacaggtcagccagcaattg
caggaagacccgctcaccggcgcgctcaaccgccgcgggctggatgccgagttcacccgt
atgcagtcgcgcgtggtgcgtcagggccagccgctcaccctggcgctgctcgacctcgat
cacttcaaggcggtgaacgacacccacggccacgatactggcgacgccgtgctcaaggcg
ctggtggcgcaggccaaacggctgatccggccgagcgaccgcgtggcgcgcatggggggc
gaggagttcatgctcctcctgcccgacacgccggtgcagcagtcgctcgtcgtggtgcag
cggctgctggttgcgttcagcgatcagaccctggtgcaggacagcacggggcggcgcatt
cccctgagtttcagcgccggggtggccgaactgtgcccggatgaagacttcgccgcgatc
tatcagcgcgtggacgccgcactgctgcaggccaagcaggcggggcgcaaacgggtggaa
ttcgccgtgccctgcgatggtgccaaggccggtggcagcctgcccaagagcgcgctgcga
ttcttcgcgcttcgggggtaa

DBGET integrated database retrieval system