KEGG   Thiomonas arsenitoxydans: THI_1641Help
Entry
THI_1641          CDS       T02347                                 

Gene name
phbA1
Definition
(GenBank) acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    THI_1641 (phbA1)
   00630 Glyoxylate and dicarboxylate metabolism
    THI_1641 (phbA1)
   00640 Propanoate metabolism
    THI_1641 (phbA1)
   00650 Butanoate metabolism
    THI_1641 (phbA1)
  Lipid metabolism
   00071 Fatty acid degradation
    THI_1641 (phbA1)
   00072 Synthesis and degradation of ketone bodies
    THI_1641 (phbA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    THI_1641 (phbA1)
   00310 Lysine degradation
    THI_1641 (phbA1)
   00380 Tryptophan metabolism
    THI_1641 (phbA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    THI_1641 (phbA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    THI_1641 (phbA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    THI_1641 (phbA1)
Enzymes [BR:thi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     THI_1641 (phbA1)
Exosome [BR:thi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THI_1641 (phbA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1633093..1634271
Genome map
AA seq 392 aa AA seqDB search
MTDIVIVSAVRTAVGKFGGALAKVSAVDLGALVIKEAVARAKLEPGQVSEVIFGQVLQAG
CGQNPARQSSIKAGLPDMVPAMTINKVCGSGLKAVMLAAQAIRDGDADIVVAGGQESMSA
SPHVLPGSRDGQRMGDWKMIDTMIVDGLWDAFNQYHMGTTAENVAKKYGITREMQDAFAA
ASQNKAEAAQKAGRFTDEIVPVMLPQRKGDPIAFANDEFVRHGVTAESLGGLRPAFDKGG
TVTAGNASGLNDGAAAVVVMSARRAAELGLKPLATIRAYANAGLDPAYMGMGPVPSSTRC
LSRAGWTPQELDLMEINEAFAAQAIAVNQQMGWDTAKVNVNGGAIAIGHPIGASGCRILV
TLLHEMNKRDAKKGLASLCIGGGMGVAMALER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatcgtcatcgtgtccgccgtgcgcacggcggtggggaaattcggcggtgcg
ctggcgaaagtgtcggcggtcgatctgggcgctctggtcatcaaggaggcggtcgcgcgc
gccaagctggagccagggcaagtgtccgaggtcatcttcgggcaagtactgcaagcgggc
tgtggacagaatccagcgcgtcagtccagcatcaaggcagggttgccggacatggtgccc
gcgatgaccatcaacaaagtctgtggctccggcctgaaggccgtgatgctggccgcccag
gcgattcgcgatggcgatgccgacattgtggtggcgggcgggcaagagagcatgagcgcc
tcgccgcatgtgctgccgggctcgcgcgacggtcagcgcatgggcgactggaagatgatc
gacaccatgatcgtcgatggcctgtgggatgcgttcaatcagtaccacatgggcaccacg
gccgagaacgtggcaaagaaatacggcatcacccgcgaaatgcaggatgctttcgccgca
gccagccagaacaaggccgaggcggcgcaaaaagccgggcgcttcaccgatgaaatcgtg
ccggtgatgctgccgcagagaaaaggcgaccccatcgcgtttgccaacgacgagttcgtg
cggcatggcgtgacggcagagagtctcggcgggctgcgtccggcattcgacaagggcggc
acggtcaccgcgggcaatgcctcgggcctcaacgacggtgctgcggcggtggtggtgatg
tcggcccggcgcgccgctgagctcggcctcaagccgctggcgaccatccgggcctatgcc
aacgcgggtctcgatccggcctatatgggcatggggccggtgccgtcttccacccgctgt
ctgtcgcgcgcagggtggacgccgcaggaactcgatctcatggagatcaacgaggcgttt
gccgcgcaggccatcgcggtgaatcaacagatgggctgggataccgccaaggtcaacgtc
aacggcggcgctattgccatcggccaccccatcggcgccagtggttgccgcattctggtg
actttgctgcacgagatgaacaagcgcgatgcgaaaaagggcctggcctcgctgtgcatc
ggcggcggcatgggcgtggccatggcgctggagcgttga

DBGET integrated database retrieval system