KEGG   Thiomonas sp. 3As: THI_1672Help
Entry
THI_1672          CDS       T02347                                 

Gene name
sucB
Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
thi  Thiomonas sp. 3As
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:thi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:thi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:thi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1660000..1661310
Genome map
AA seq 436 aa AA seqDB search
MALIDIKVPQLSESVAEATLLTWKKKPGEPVAQDEILIEIETDKVVLEVPAPEAGVMAQI
VKNDGELVTSDEVIAKIDTEAKPQTSPLPVAPVKAAEPAASAPTAIASAVAPAAPSAGAA
VAMPAAAKIMAEQGVNPSDVAGTGRGGRITKGDALQAAAAPKPPTVPAPTPAPKPATAAA
AMPSLTIPALQPVEADLDLAAYTDRPEQRVPMSRLRARIAERLLQSQATNAILTTFNEVN
MKPVIDMRNLYKDKFEKQHGVKLGFMSFFVRAAVHALRKFPLLNASIDGNDIVYHGYFDI
GIAVGSPRGLVVPILRNADQMSFADIEKAIADFGAKARDGKLTIEELTGGTFSISNGGVF
GSMLSTPIINPPQSAILGIHATKDRPVVEDGQIVIRPMNYLAMSYDHRLIDGREAVLGLV
AMKEALEDPARLLLDL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgatcgacatcaaagttccccaactctccgaatccgtggctgaagccactctg
ctgacctggaagaaaaagcccggcgaacccgtggcgcaggatgaaatcctgattgaaatc
gagaccgacaaagtggtgctcgaagtgcccgctcccgaagccggggtgatggcgcagatc
gtcaagaacgacggcgaattggtgaccagcgacgaagtcatcgccaagatcgacactgaa
gccaagccgcagaccagcccgttgcccgtggcgccagtcaaggcggctgaaccggctgct
tcggctccgaccgcgattgcatctgcagttgcgcctgcggcgccctccgcaggcgcggcg
gtggctatgccggctgcggcgaagatcatggccgagcagggcgtgaatccgtcagacgtg
gcgggcaccgggcgcggcggccgcattaccaagggcgatgccttgcaggctgcggctgcg
cccaagccgccgaccgttccagccccaacgcccgcgccgaaaccggcgaccgctgcggcc
gcaatgccctcgctcactatccccgcgttgcagccggtggaggccgatctcgatctcgcc
gcctacaccgaccggcccgaacagcgcgtgccgatgagccgcctgcgcgcgcgcatcgcc
gaacggctgctgcagtcgcaggccaccaacgccatcctcaccaccttcaacgaagtgaac
atgaagccggtgatcgacatgcgcaatctgtacaaagacaagttcgagaagcagcacggc
gtgaagctgggtttcatgagcttttttgtgcgcgccgcggtgcatgcgctgcgcaagttc
ccgctgctcaacgcctcgatcgacggcaatgacatcgtctatcacggctacttcgacatc
ggcatcgccgtgggcagtccgcgcgggctggtggtgcccattctgcgcaatgccgatcag
atgagttttgccgacatcgaaaaagccatcgccgattttggtgccaaggcacgtgacggc
aagctgaccatcgaggagctcaccggcggcaccttctccatcagcaacggcggagtgttc
ggctcgatgctgtccacgcccatcatcaatccgccgcagtcggccattctgggcatccac
gccaccaaagaccgacccgtggtcgaagacggtcagatcgtgattcgcccgatgaactac
ctggcaatgagctacgaccatcgcctgatcgacggccgcgaagcggtgctcggcctggtg
gcgatgaaagaggcgctcgaagaccccgcgcgtctgctgctcgatctttga

DBGET integrated database retrieval system