KEGG   Thiomonas arsenitoxydans: THI_1747Help
Entry
THI_1747          CDS       T02347                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THI_1747 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    THI_1747 (aceA)
Enzymes [BR:thi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     THI_1747 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1730229..1731536
Genome map
AA seq 435 aa AA seqDB search
MADRKQQVAALEQDWAQNSRWKGIKRGYGAEEVVRLRGSVMVEHTLARRGADRLWKQMHD
MPFVNALGALTGNQAMQQVKAGLQAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPSVVK
RINNTLTRADQIQWMEGKQPGDEGFIDYFAPIVADAEAGFGGVLNAFELMKSMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTREAVAKLVAARLAADVMGVPTVLVARTDAEAADLIT
SDVDDTDKPFCTGERTVEGFYRTKPGLEQAISRGLAYAPYADLVWCETGKPDLAYAKAFA
EAIHAKFPGKMLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSM
FNLAYGYARNQMSAFVELQEAEFAAAPKGFTAVKHQREVGTGYFDAVTTTIENEASTAAL
KGSTEDEQFFDRKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcgcaaacagcaagtggcagcgttggaacaggactgggcgcagaactcgcgc
tggaagggcatcaagcgcggttatggcgcagaggaagtggtgcgcctgcgcggttcggtg
atggttgagcatacgctggcccgtcgcggtgcggatcgtctttggaagcagatgcacgac
atgccgttcgtcaacgccctgggcgccttgactggcaaccaggccatgcagcaggtcaag
gccggcctgcaggccatctacctgtcgggctggcaagtggcgggtgatgccaacctggct
ggcgagatgtatcccgaccagtcgctgtatccggccaactcggtgcccagcgtggtcaag
cgcatcaacaacaccctcacccgagccgatcagattcagtggatggaaggcaagcagccc
ggtgacgaaggcttcatcgactatttcgcccccatcgtggccgatgccgaagccggtttc
ggcggcgtgctcaacgccttcgagctgatgaagtccatgatcgaggccggcgccgccggc
gtgcacttcgaagaccagttggcctcggtgaagaaatgcggccacatgggcggcaaggtg
ctggtgccgactcgcgaggctgttgccaagctcgtggcagcgcgcctggcggccgacgtc
atgggcgtgccgacggtgctggtggcgcgcaccgacgccgaagcggccgacctgatcact
tccgacgttgacgataccgacaagcccttctgcactggcgagcgcacggtcgaaggcttc
taccgcaccaagcccggcctggagcaggccatctcccgcggtctggcctacgcgccctat
gccgatctggtgtggtgcgaaaccggcaagcccgacctcgcctacgccaaggccttcgct
gaagccattcatgccaagttccccggcaagatgctggcctacaactgctcgccgtccttc
aactggaagaagaacctcgacgatgccaccatcgccaagttccagaaggaattgggcgcc
atgggctacaagttccagttcatcaccctggccggtttccacgcgctgaactattcgatg
ttcaacttggcctacggctatgcccgcaaccagatgagcgccttcgtcgagttgcaagag
gccgaattcgccgcagcgcccaagggcttcaccgcggtcaagcatcaacgcgaggtcggc
accggctatttcgacgccgtcaccacgacgatcgagaacgaggcttccaccgccgcgctc
aagggttcgaccgaagacgagcagttcttcgaccgcaaagtggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system