KEGG   Thiomonas arsenitoxydans: THI_2087Help
Entry
THI_2087          CDS       T02347                                 

Definition
Putative Asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    THI_2087
Enzymes [BR:thi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     THI_2087
Peptidases [BR:thi01002]
 Cysteine Peptidases
  Family C44
   THI_2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2036656..2038572
Genome map
AA seq 638 aa AA seqDB search
MCGIAGRLNWNAPIDPAQLAAMIGQLHHRGPDQQGFYNKGPIGLAHARLSIIDLSGGDQP
MCNEDGTVWVVFNGEIFNYIELRAELQRRGHRFATQSDTEVLVHLYEDHGDALVDQLNGQ
FAFALWDVPRQRLLLARDRTGIRPLFHTRVPGGLAFASEVKALFALPEVPRRLDAKALGE
VFTYWAPLPPHAVFEGIESLPPGHMMSVDARGTQTRRYWDWSFPPASIEDERSAAACADE
LRDLLIDAVRLQLRADVPVAAYLSGGLDSSIVTTLICHYTDTPLRTFSLTFDDAEFDESP
WQQQLVRHLGTDHTTVHCTRADIAAAFPRTIAHTETPIVRTAPAPMMLLAAGVRAAGYKV
ALTGEGADEVFGGYDLFKEARVRRFMARQPASRWRPRLLERLYPYLKHSPAAGRAMTERF
FREGEAHFREPWFAHLPRWTTTRRITGFLSPEWRAAATAADPIATLAAQLPADISRWEPL
CQDQYIEAHTLMSGYLLCSQGDRMAMAQSIETRFPFLDHRLIAFASQLPPRYKLMGLVEK
YLLKRSMDGLLPDALRHRTKQPYRAPDSQSFFHNGEPVDYVADLFSVARLKEAGYFDPEA
AIRLFDKARAGKVIGFGDNMAFVGMLSTLLLHDQFIRR
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcattgcgggtcgcctgaactggaacgcgcccatcgatcccgcgcagcttgcc
gcgatgatcggccagctgcatcaccgcgggcctgatcagcaggggttctacaacaaagga
ccgatcggtctggcccacgcccgcctgagcatcatcgacctgtccggcggcgaccagccg
atgtgcaacgaagacggcacggtatgggtggtcttcaacggcgagattttcaattacatc
gaactgcgcgccgagctgcagcgccgcggccatcgcttcgccacgcagtccgataccgaa
gtgctggtgcacctgtatgaagaccacggcgacgcgctggtcgatcagctcaacggccag
ttcgccttcgccctgtgggacgtgccgcgtcagcgcctgctgctggcccgcgaccgcacc
ggcatccggccgctgtttcacactcgcgtgccgggcggtctggcctttgcctccgaggtc
aaggccttgttcgccctgcccgaagtgccgcgccgtctggatgcgaaagcgctgggcgaa
gtcttcacctactgggcacccctgccgccacacgccgtattcgagggcatcgagtctctg
ccgcccggccatatgatgtcggtcgacgctcgcggcacgcagacgcgccgctattgggat
tggagctttcccccagcctcgatcgaagacgagcgctcggccgccgcctgcgccgacgag
ctgcgcgacctgctgatcgacgcggtgcggctgcaactgcgcgccgatgtgcccgtggcc
gcctatctcagcggcggcctcgattcttccatcgtcaccaccctgatctgccactacacc
gacacgccgctgcgcactttttccctcactttcgacgacgccgaattcgacgaaagcccc
tggcagcagcaactcgtgcgccacctgggcaccgatcacaccacggtgcactgcacccgc
gccgacatcgccgccgccttcccgcgcaccattgcccacactgagacacccatcgtgcgc
accgcccccgcgcccatgatgctgctggccgcaggggtgcgcgccgcgggctacaaggtg
gcgctcactggcgaaggcgccgacgaagtcttcggcggctacgacctgttcaaggaagcc
cgggtgcgccgcttcatggcccggcagcccgcttcgcgctggcgccctcgcctgctcgaa
cgcctctacccctatctcaaacactccccggccgccggccgcgcgatgaccgagcgtttt
ttccgcgaaggcgaagcgcatttccgcgagccctggttcgcccacctgccgcgctggacc
accacacggcgcatcaccggctttctgtcgccggaatggcgcgccgcggccacggcggcc
gaccccatcgccaccctcgccgcgcaactccccgccgacatctcgcgctgggagccgctc
tgccaggatcagtacatcgaggcgcataccctgatgtcgggctatctgctgtgttctcag
ggcgatcgcatggccatggcgcagtccatcgagacccgttttcccttcctcgatcaccgg
ctgatcgccttcgccagccaactccctccgcgctacaaactcatgggcttggtggaaaaa
tacctgctcaaacgcagcatggacggcctgctgcccgacgcgctgcgccatcgcaccaag
caaccttaccgcgcccccgacagccagagtttttttcacaatggcgaacccgtcgattac
gtggccgacctgttcagcgtggcgcgcctcaaagaggcgggctacttcgacccggaggcg
gcgattcgcctgttcgacaaggcacgcgctggaaaagtcatcggctttggtgacaatatg
gcctttgtcggcatgctctccaccctgcttctgcacgaccagttcatccggcgctga

DBGET integrated database retrieval system