KEGG   Thiomonas arsenitoxydans: THI_2228Help
Entry
THI_2228          CDS       T02347                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    THI_2228 (galU)
   00052 Galactose metabolism
    THI_2228 (galU)
   00500 Starch and sucrose metabolism
    THI_2228 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    THI_2228 (galU)
Enzymes [BR:thi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     THI_2228 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2183854..2184741
Genome map
AA seq 295 aa AA seqDB search
MPPTITKAVFPVAGLGTRFLPATKATPKEMMPVVDKPLIQYAVEEAYAAGITEMIFVTGR
HKRAIEDHFDTAYELEHQLEEAGKQAMLDVVRSVKPDNVQCVFVRQPVANGLGAAVLCAE
RLVGDEPFAVILADDLLVGEPPVMAQMVEIHSRHGRSVLATEEVPREHTKRYGIVSGQEI
TPGLTSLSGIVEKPAPDVAPSTQAVVGRYILSPRVFHHLRNGKPGAGGEIQLTDGISALL
HEEAVYAYRYSGRRFDCGSKLGYLEATVQLGMSHPETGPEFSAYINNLCAGHAAS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgaccatcaccaaagccgtcttccccgttgccggtctcggcacgcgttttctg
cccgcgaccaaagccactccgaaagagatgatgcccgtggtcgacaagccgctcattcaa
tatgcggtcgaagaggcctatgcggcgggcatcaccgaaatgatttttgtcaccggccgc
cacaagcgcgccatcgaggatcatttcgacaccgcctacgaactggagcatcaacttgaa
gaagcgggcaaacaggccatgctcgacgtggtgcgcagtgtcaaacccgacaacgtgcag
tgcgtgttcgtgcgccagcccgtggccaacggcctaggcgcggcggtactttgcgctgag
cgtctggtgggcgacgagccgtttgccgtcatcctcgccgatgacttgctcgtcggcgag
cctcccgtcatggcgcaaatggtcgagattcacagccgccatggccgcagcgtcctcgcc
accgaagaagtgccgcgcgagcacaccaaacgctacggcattgtcagcgggcaggaaatc
acacccgggctgacctcgctgtcgggcatcgtcgaaaaacccgctccagacgtcgcgccc
agcacccaggcggtcgtgggtcgctacatcctcagcccccgtgtgtttcatcatctgcgc
aacggcaaacccggcgccggaggcgaaattcagctcaccgacggcatctccgcgctgctg
catgaagaagcggtgtacgcctatcgctacagcggccgccgtttcgactgtggcagcaag
ctcggctatctcgaagccacggtgcaactgggcatgtctcaccccgagaccggaccggaa
ttcagcgcctatatcaacaatttgtgcgcaggccacgcagcaagctaa

DBGET integrated database retrieval system