KEGG   Thiomonas arsenitoxydans: THI_2266Help
Entry
THI_2266          CDS       T02347                                 

Definition
conserved hypothetical protein, putative HemX protein
Orthology
K02496  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THI_2266
Enzymes [BR:thi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     THI_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2217582..2218733)
Genome map
AA seq 383 aa AA seqDB search
MTEPSTLPEAEPSPAQAPAAAQVAASAAASPEPAAMPPSAELTKSAPVGLPGARWVWPVL
VALVVALVAMAWWLNNRLYATQAEIAQRLQTATTDAIEAKTLTKQANDSVRDLTTRLAVL
ESRQQDFAAQRQALETLYADFAKTRDQARLSETGQLIALAQQQAQLIGNVQPLIATLQSA
DARLARSPNPKAQILRRAVQSDLTRLRSAVTPDIAAAAHKLNDLAALVDSLRLVSAAGPA
HGASAPGTPPVAPASAAGPRWAPWLGDWFERFRASLVQLFGITRVGSRDALLASPQQGEF
LRENLKLRILNARLDLLSRNAVAYRSDMRGIDEALKTYFDKRQPRMVQALSLARQAAQLD
LSANPAANLESLAVLSTLDSGAP
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcccagcacccttcccgaggcagagccttctccggcgcaagcgcctgcggct
gcgcaggttgctgcttcggctgcagcttctcctgagcctgcggccatgccaccatcggcg
gaactgacgaagtcggcgcctgtcggcctgccgggcgcccgctgggtctggccggttctc
gttgccctcgtcgtcgctctggtggcgatggcgtggtggctgaacaaccgcctgtatgcc
acccaggcggaaattgcgcagcgcctgcaaaccgcaacgaccgatgccatcgaggccaag
accctgaccaaacaggccaacgattcggtgcgcgatctcacgacgcggctcgcggtgctc
gaatcgcgccagcaagacttcgcggcgcagcgtcaggcgctggagacgttgtatgcagac
tttgccaagacccgcgatcaggcccgcctgtccgaaaccggtcagctcatcgccctggcg
cagcagcaggcccagctgatcggcaatgtgcagccgctcatcgccaccctgcaaagcgcc
gatgcgcgactggcgcgctcgcccaatcccaaggcgcaaatcctgcgccgcgcggtgcag
tccgacctgacgcggctgcgcagcgccgtcacgcccgacatcgccgcagccgcgcacaaa
ctcaacgatctggccgcgctggtggatagtttgcggctggtttcggcggcgggaccggcc
cacggcgccagcgcaccgggcaccccgcccgtggccccggcgtcggccgcaggcccgcgc
tgggcgccgtggctgggcgactggttcgagcgctttcgcgcctcgctggtgcagttgttc
ggcatcacccgcgtgggctcgcgcgatgctttgctggcttcgccgcagcagggcgaattc
ctgcgcgagaatctcaaactgcgcatcctcaatgcccgtctcgatctgctttcgcgcaat
gcggtggcgtatcgcagcgatatgcgaggcatcgatgaagcgctgaaaacctatttcgac
aagcgccagccgcgcatggtgcaggcgctgtcgctcgcccgtcaggccgcccagctcgac
ctctcggccaatcccgcagccaatctggagtcgctggccgtgctctccacgctggatagc
ggagccccctga

DBGET integrated database retrieval system