KEGG   Thiomonas arsenitoxydans: THI_2267Help
Entry
THI_2267          CDS       T02347                                 

Definition
putative Uroporphyrinogen III synthase (U3S, HemD)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THI_2267
Enzymes [BR:thi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     THI_2267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2218743..2219750)
Genome map
AA seq 335 aa AA seqDB search
MLNTTLISTRASSQSGGAHEILAAAGVQMLDFPLQHIGPPGDLPRFHAALAALPQTDLAI
PVSPTAVAAVFAALRQPWPARCAIGVVGEGSLRAVRRALTAQPDDVPWPRLIAPGAAPPG
QGFAQPAPRGGQENLGRPGVFLRAPQGRASPSPPPEGVKETWGRPCVSLRGDEPGGEGDS
EALWNALQLAFAPGPVASFPWAGRHALIFRGGPGRDLLQRKLEAAGAKVKVIEAYSRLAP
EYNAQTAALLQTALGSGGWWLFSSTEAVHNLQRLLEPAGLDAAVLHPQRALAIHPRIASA
LSEAGFGRVELTRAPLEEVLSTLHRLASAPSLTDS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacaccacgctgatctccacccgggcgtcctcgcagtctggaggggcgcacgag
attttggccgcagccggtgtgcagatgctcgactttccactgcaacacatcggcccgccg
ggcgatctgccccgttttcacgctgccttggccgctttgccacagaccgatcttgccatt
cccgtcagccctacggcggtggctgcggtgttcgcggcgctgcgccagccctggcccgca
cgttgcgccatcggcgtcgtcggcgagggcagcttgcgcgcggtacgccgggctttgacc
gcgcagcctgacgacgtaccgtggccgcggctcatcgcgccgggcgcggcgcccccaggg
cagggcttcgcccagcccgccccccgagggggtcaagaaaacttggggcggcccggagtt
ttcttgagagcgccccagggccgggcttcgcccagcccgccccccgagggggtcaaggaa
acttgggggcggccctgcgtttccttgagaggcgatgagccgggcggcgagggcgactcc
gaggccttgtggaacgcgctgcaactcgctttcgccccggggccggtggcgtcttttccg
tgggccgggcgccatgcgctgatcttccggggcgggccgggccgcgacctgctgcaacgc
aagctcgaagcggcgggcgccaaggttaaagtcatcgaggcctacagtcggctggcaccc
gaatacaacgcgcagaccgcggcgttgctgcagactgcgctgggtagcggcggctggtgg
ctgttttcctcgactgaggccgtgcataacctgcagcgcttgctcgaaccggccgggctg
gacgcagccgtgctgcacccgcagcgagcgctggccatccacccgcgcatcgccagcgcc
ttgagcgaagcaggcttcgggcgggtggaactgacccgcgcgccgcttgaagaggtgctg
tccactttgcatcgtctggcctcagccccgagcctgacagactcctag

DBGET integrated database retrieval system