KEGG   Thiomonas sp. 3As: THI_2289Help
Entry
THI_2289          CDS       T02347                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
thi  Thiomonas sp. 3As
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:thi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2244380..2244991)
Genome map
AA seq 203 aa AA seqDB search
MHEAAPGHVPALDALIDALRHLPGVGPKSASRMAYHLLEHDREAAQHIARALDAALGAVQ
RCARCNTLTEDAVCSICADPRRDARQLCVVESPADLAAVEQTLTYHGLYFVLMGRISPLD
GLGPKEIGLDRLMTRALDGAVEEVILATNFTNEGEATAHVIAETLRPRGLRVTRLARGVP
AGAELEYVDLGTIARALVDRRGT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaggccgcgcccggccatgtgcccgcgctcgacgcgctgatcgacgccctgcgg
catttgcccggcgtcgggccgaagtcggcgtcgcgcatggcctatcacctgctcgaacac
gaccgcgaggcagcgcagcacatcgcccgcgcgctcgacgcggcgctaggcgcggtgcaa
cgctgcgcgcgctgcaacaccctcaccgaagacgcggtctgcagcatctgcgccgacccc
agacgcgacgcccgccagctttgcgtggtggaaagccccgccgatctcgccgcggtagag
cagacgctcacctaccacggcctgtacttcgtgctcatgggccgcatcagcccgctcgat
ggcttggggccgaaggaaatcggcctcgaccggctgatgacccgcgcgctcgacggcgcg
gtggaagaggtgattctggcgaccaacttcaccaacgaaggcgaggcgacggcgcatgtc
atcgccgaaaccctgcgtccgcgcggcctgcgcgttacccgcctggcgcgcggcgtgccc
gccggggccgagctggagtatgtcgatctcggcaccatcgcccgggcgctggtcgaccgg
cgcggcacttga

DBGET integrated database retrieval system