KEGG   Thiomonas arsenitoxydans: THI_2441Help
Entry
THI_2441          CDS       T02347                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00260  Glycine, serine and threonine metabolism
thi00750  Vitamin B6 metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01230  Biosynthesis of amino acids
Module
thi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THI_2441 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    THI_2441 (thrC)
Enzymes [BR:thi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     THI_2441 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CAZ89070
UniProt: D6CUV1
Position
complement(2406653..2408095)
Genome map
AA seq 480 aa AA seqDB search
MRYLSTRGESATRGFSDILLEGLAPDGGLYLPESYPLIDSATLAQWRGLSYADLAFEILS
RFITDIPADDLRALIAKTYTPEVFGGHAEIVPLKPLKGDPGMALLGLSEGPTLAFKDMAM
QLLGNLFEYALARQHSELNIFGATSGDTGSAAEYAMRGKRGIRVFMLSPFGKMSAFQTAQ
MYSLADANIHNIAVQGVFDDAQDMVKAVSNDLDFKRRWRIGTVNSINWARLAAQIVYYFA
GYFQATRSNDEQVSFTVPSGNFGNICAGHVARMMGLPIRKLVLATNENNVLDEFFRTGVY
RPRKSAETHHTSSPSMDISKASNFERFIFDLLGRDASRVHALFADELPSRGFFDLSADPA
FARSATDYGFTSGSSTHADRLATIRSVWQGSERLIDTHTADGVKVAREHLEPGVPMLVLE
TALAAKFPETIQEAVGTCPQRPAGLEDLERRPQRFAVMPVEVEAVKTYIAMHCGAGLAGS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatctgagtacccgcggcgagtccgcgacccgaggtttttccgacatcctgctc
gaagggctggcgcccgatggcgggctctatctgcccgaaagctatccgctgatcgatagc
gccacgctggcgcaatggcgcgggctgtcttacgccgatctggcttttgagattctgtcg
cgtttcatcaccgacattccggcggacgatctgcgcgcgctgatcgccaagacctacacg
cccgaggtgttcggcggccatgccgagatcgtgccgctcaaaccgctgaaaggcgatccg
ggcatggcgctgctgggcttgtccgaagggccgacgctggcgttcaaggacatggccatg
cagttgctcggcaatctgttcgagtacgcgctggcccgccagcacagcgaactcaatatt
ttcggcgcgacctcgggcgataccggcagcgcggccgaatatgccatgcgcggcaagcgc
ggtattcgcgtgttcatgctctcgcccttcggcaagatgagcgcgtttcagaccgcgcag
atgtattcgctggccgacgccaacatccacaacattgcggtgcaaggcgtgttcgacgat
gcgcaggacatggtcaaggccgtgtccaacgacctcgacttcaagcgccgctggcgcatc
ggcacggtcaactccatcaactgggcgcggcttgcggcgcagatcgtctattacttcgcc
ggttacttccaggccacgcgcagcaacgacgagcaggtgagcttcacggtgccgtcgggc
aacttcggcaacatctgcgccgggcatgtggcgcgcatgatgggtctgccgatccgcaag
ctggtgctggccaccaacgaaaacaacgtgctcgacgagttcttccgcaccggcgtctat
cgtccgcgcaaatcggcggaaacacatcacacctctagcccgtcgatggatatctccaaa
gcctcgaacttcgagcgcttcatcttcgatctgctcgggcgcgacgcttcgcgcgtgcac
gcgctgttcgcggacgaactgccgagcaggggctttttcgacctctcggccgacccggcg
tttgccaggagtgcgaccgactacggcttcacctcgggcagcagcacccatgccgaccgg
ctcgccaccatccggagcgtgtggcagggcagcgaacggttgatcgacacccataccgcc
gacggcgtgaaagtggcgcgcgaacacctggagccgggcgtgcccatgctggtgctcgaa
acggcgctggccgccaagttccccgaaacgattcaggaagccgtgggtacctgcccgcag
cgcccggccggactcgaagacctcgaacgccgcccgcagcgttttgccgtcatgccggtc
gaggtggaggcggtgaagacctatattgcgatgcactgcggcgcggggctggcgggctcc
tga

DBGET integrated database retrieval system