KEGG   Thiomonas sp. 3As: THI_2441Help
Entry
THI_2441          CDS       T02347                                 

Gene name
thrC
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
thi  Thiomonas sp. 3As
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:thi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:thi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:thi00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2406653..2408095)
Genome map
AA seq 480 aa AA seqDB search
MRYLSTRGESATRGFSDILLEGLAPDGGLYLPESYPLIDSATLAQWRGLSYADLAFEILS
RFITDIPADDLRALIAKTYTPEVFGGHAEIVPLKPLKGDPGMALLGLSEGPTLAFKDMAM
QLLGNLFEYALARQHSELNIFGATSGDTGSAAEYAMRGKRGIRVFMLSPFGKMSAFQTAQ
MYSLADANIHNIAVQGVFDDAQDMVKAVSNDLDFKRRWRIGTVNSINWARLAAQIVYYFA
GYFQATRSNDEQVSFTVPSGNFGNICAGHVARMMGLPIRKLVLATNENNVLDEFFRTGVY
RPRKSAETHHTSSPSMDISKASNFERFIFDLLGRDASRVHALFADELPSRGFFDLSADPA
FARSATDYGFTSGSSTHADRLATIRSVWQGSERLIDTHTADGVKVAREHLEPGVPMLVLE
TALAAKFPETIQEAVGTCPQRPAGLEDLERRPQRFAVMPVEVEAVKTYIAMHCGAGLAGS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatctgagtacccgcggcgagtccgcgacccgaggtttttccgacatcctgctc
gaagggctggcgcccgatggcgggctctatctgcccgaaagctatccgctgatcgatagc
gccacgctggcgcaatggcgcgggctgtcttacgccgatctggcttttgagattctgtcg
cgtttcatcaccgacattccggcggacgatctgcgcgcgctgatcgccaagacctacacg
cccgaggtgttcggcggccatgccgagatcgtgccgctcaaaccgctgaaaggcgatccg
ggcatggcgctgctgggcttgtccgaagggccgacgctggcgttcaaggacatggccatg
cagttgctcggcaatctgttcgagtacgcgctggcccgccagcacagcgaactcaatatt
ttcggcgcgacctcgggcgataccggcagcgcggccgaatatgccatgcgcggcaagcgc
ggtattcgcgtgttcatgctctcgcccttcggcaagatgagcgcgtttcagaccgcgcag
atgtattcgctggccgacgccaacatccacaacattgcggtgcaaggcgtgttcgacgat
gcgcaggacatggtcaaggccgtgtccaacgacctcgacttcaagcgccgctggcgcatc
ggcacggtcaactccatcaactgggcgcggcttgcggcgcagatcgtctattacttcgcc
ggttacttccaggccacgcgcagcaacgacgagcaggtgagcttcacggtgccgtcgggc
aacttcggcaacatctgcgccgggcatgtggcgcgcatgatgggtctgccgatccgcaag
ctggtgctggccaccaacgaaaacaacgtgctcgacgagttcttccgcaccggcgtctat
cgtccgcgcaaatcggcggaaacacatcacacctctagcccgtcgatggatatctccaaa
gcctcgaacttcgagcgcttcatcttcgatctgctcgggcgcgacgcttcgcgcgtgcac
gcgctgttcgcggacgaactgccgagcaggggctttttcgacctctcggccgacccggcg
tttgccaggagtgcgaccgactacggcttcacctcgggcagcagcacccatgccgaccgg
ctcgccaccatccggagcgtgtggcagggcagcgaacggttgatcgacacccataccgcc
gacggcgtgaaagtggcgcgcgaacacctggagccgggcgtgcccatgctggtgctcgaa
acggcgctggccgccaagttccccgaaacgattcaggaagccgtgggtacctgcccgcag
cgcccggccggactcgaagacctcgaacgccgcccgcagcgttttgccgtcatgccggtc
gaggtggaggcggtgaagacctatattgcgatgcactgcggcgcggggctggcgggctcc
tga

DBGET integrated database retrieval system