KEGG   Thiomonas sp. 3As: THI_2466Help
Entry
THI_2466          CDS       T02347                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
thi  Thiomonas sp. 3As
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:thi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2430581..2431786)
Genome map
AA seq 401 aa AA seqDB search
MKTVTILGSTGSIGTNTLAVLALHPEQFRVFALAAHSNADKLFAQCLEFRPNYAVLGSAQ
AASSLQQRLRAEHCPTEVLSGPRALDDVAAAPEVDLVMAAIVGAAGLSASLAAARAGKRL
LLANKESLVVAGDLLLQALAQGGGDLIPIDSEHSAIQQSLPDDRSRWQADVRNIVLTASG
GPFRQRAAHTLQAVTPTEACAHPNWSMGAKISVDSATMMNKALEVIEAHYLFGMRPEQIE
VLIHPQSIVHSMVNYHDGSVIAQLGQPDMRTPIAYGLSYPARMASGAPWLDLARVGRLDF
EQPDPQRFPGLALAFEALRMPVGACAVLNAANEVAVDAFLHQRIRFTDIHRINADLLASA
QCAGCDSLEALAELDVHTRLQAQQRVAQLSPSGRGGAAQLA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggtcaccattctcggctctaccggctcgatcggcaccaatacgctggccgtg
ctggcgctgcacccagagcagtttcgggtgtttgccctggccgcgcacagcaatgccgac
aaactgtttgctcagtgtcttgaatttcgcccgaactacgccgtgctcggcagtgcgcag
gcggccagcagcctgcagcaacgtttgcgcgccgagcattgcccgacggaagtattgagc
ggcccccgggcgctcgacgacgtggcggccgcgcccgaagtcgatctggtcatggccgcc
atcgtgggcgccgccggtctgtcggccagcctcgccgcggcccgtgccggcaagcggctg
ctgctggccaacaaagagtcgctggtcgtcgccggcgatctactgttgcaggccttggcg
caaggcggcggcgatctcattcccatcgacagcgaacacagcgccattcagcaaagtctg
cccgatgatcgcagccgctggcaggcggacgtgcgcaacatcgtgctgaccgcttcgggc
gggccgtttcgccagcgtgccgcgcacaccttgcaggcggtcacgccgacggaggcctgc
gcccacccgaactggagcatgggcgcgaagatctcggtcgattccgccaccatgatgaac
aaggcgctggaggtcatcgaggcgcactatctgttcggcatgcggcccgaacagatcgag
gtgctgatccatccccagagcatcgtgcattcgatggtcaactatcacgacggctcggtg
attgcccaactcgggcagcccgatatgcgcacccctattgcctacggcctgtcctatccc
gcccgcatggcctcgggcgcgccgtggctcgacctggcgcgcgtgggacggctcgatttc
gaacaacccgatccccagcggttcccgggcctggccttggccttcgaggctctgcgcatg
ccggtgggcgcctgcgccgtgctcaatgccgccaacgaagtggccgtggacgccttcctt
catcagcgcatccggtttaccgatattcaccggatcaatgcggatttgctggcaagtgca
caatgcgcgggctgtgattccctggaggccctggctgaactagacgtccatacgcgactc
caagcgcaacagcgcgtcgcgcaactctctccctccgggcggggcggcgcggcgcaactg
gcctga

DBGET integrated database retrieval system