KEGG   Thiomonas sp. 3As: THI_2476Help
Entry
THI_2476          CDS       T02347                                 

Gene name
tesA
Definition
Acyl-CoA thioesterase I precursor (Protease I) (Lysophospholipase L1) (Lecithinase B) (EC:3.1.2.- 3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
thi  Thiomonas sp. 3As
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:thi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2439976..2440599
Genome map
AA seq 207 aa AA seqDB search
MGLADAARAAIPPVSTPIATLLVVGDSLSAGYGLETGKGWVDLLRQRLEAKEPRWTVINA
SISGDTTAGGLARLPALLARDKPRVVIIELGGNDALRGLSLQQTQNNLSRMVALCKKAGA
HVLLVGMQIPPNYGPAYTARFAAVFPAVAKSQRVAQVPFLLSGVVGHPDWFQSDNIHPTA
QAQPTMLDTVWPYLAPLLALPAARSAP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggggctagcggacgccgctcgggccgccataccgcctgtatccacgcccatagccact
ctgctcgtggtgggcgacagcctgtctgccggatacgggctggagacgggaaaaggctgg
gtcgatctgctgcgccagcggctcgaagccaaagagccgcgctggaccgtgatcaacgcc
agcatcagcggcgacaccactgcgggcgggctggcccggctgcccgccctgctcgcgcgc
gacaagccgcgcgtggtcatcattgagctgggcggcaacgatgccctgcgcggtctttcc
ttgcagcaaacgcagaacaatctgagccgtatggtcgcgctgtgcaaaaaggcgggcgcg
catgttttgctggtcggtatgcaaattccgccaaactacggcccggcgtacaccgcgcgt
tttgcggccgtgtttccggcggttgcaaaatcgcagcgtgtggcgcaggtcccgtttctg
ctttctggcgtcgtcggccatcccgattggtttcagtccgacaacattcaccccaccgca
caagcgcaacccaccatgctcgataccgtctggccgtacctcgcccctttgctggccctg
cctgccgcgagatcggcgccatga

DBGET integrated database retrieval system