KEGG   Thiomonas arsenitoxydans: THI_2476Help
Entry
THI_2476          CDS       T02347                                 

Gene name
tesA
Definition
Acyl-CoA thioesterase I precursor (Protease I) (Lysophospholipase L1) (Lecithinase B) (EC:3.1.2.- 3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    THI_2476 (tesA)
Enzymes [BR:thi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     THI_2476 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     THI_2476 (tesA)
Lipid biosynthesis proteins [BR:thi01004]
 Fatty acid synthase
  Component type
   THI_2476 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2439976..2440599
Genome map
AA seq 207 aa AA seqDB search
MGLADAARAAIPPVSTPIATLLVVGDSLSAGYGLETGKGWVDLLRQRLEAKEPRWTVINA
SISGDTTAGGLARLPALLARDKPRVVIIELGGNDALRGLSLQQTQNNLSRMVALCKKAGA
HVLLVGMQIPPNYGPAYTARFAAVFPAVAKSQRVAQVPFLLSGVVGHPDWFQSDNIHPTA
QAQPTMLDTVWPYLAPLLALPAARSAP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggggctagcggacgccgctcgggccgccataccgcctgtatccacgcccatagccact
ctgctcgtggtgggcgacagcctgtctgccggatacgggctggagacgggaaaaggctgg
gtcgatctgctgcgccagcggctcgaagccaaagagccgcgctggaccgtgatcaacgcc
agcatcagcggcgacaccactgcgggcgggctggcccggctgcccgccctgctcgcgcgc
gacaagccgcgcgtggtcatcattgagctgggcggcaacgatgccctgcgcggtctttcc
ttgcagcaaacgcagaacaatctgagccgtatggtcgcgctgtgcaaaaaggcgggcgcg
catgttttgctggtcggtatgcaaattccgccaaactacggcccggcgtacaccgcgcgt
tttgcggccgtgtttccggcggttgcaaaatcgcagcgtgtggcgcaggtcccgtttctg
ctttctggcgtcgtcggccatcccgattggtttcagtccgacaacattcaccccaccgca
caagcgcaacccaccatgctcgataccgtctggccgtacctcgcccctttgctggccctg
cctgccgcgagatcggcgccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system