KEGG   Thiomonas arsenitoxydans: THI_2516Help
Entry
THI_2516          CDS       T02347                                 

Gene name
arcA
Definition
Arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THI_2516 (arcA)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    THI_2516 (arcA)
Enzymes [BR:thi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     THI_2516 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2480224..2481144
Genome map
AA seq 306 aa AA seqDB search
MSASPVIHLIGAPTDIGAADRGASMGPEALRVAGIDRALRAQGLTVLDTGNLIGPHNPWQ
PPACGYRHLPEVIAWNTAVHQAVGDALRAQALPILLGGDHCLAIGSLSAVAQHCRAQGRK
LRVLWLDAHADFNTHTVTPTGNLHGMPVACLCGKGPQALTTLGGPAPQLQPSCIRQIGIR
SVDAEEKRLVHQAGLDVFDMRYIDEYGMRDAMRRALEGVDADTHLHVSFDVDFLDPDIAP
GVGTTVPGGPTYREAQLCMEMIADTGLLASLDVVELNPAFDERNRTAEVAVDLIESLFGK
STLMRR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccagccccgtcattcatctcatcggcgcgcccaccgacatcggcgctgcagac
cgtggcgcctccatggggccggaagcgctgcgcgtggccggcatcgaccgcgccctgcgc
gctcagggcctgacggtgctcgataccggcaatctcatcggcccgcacaacccttggcag
ccgccggcctgcggctatcgccatctgcccgaagtcatcgcctggaacaccgcggtgcat
caggccgtgggcgatgccttgcgggctcaagccctacccatcctgctgggcggcgatcat
tgcctggccatcggctcgctcagcgcagtggcgcagcattgccgcgcacagggtcgcaag
ctgcgcgtgctgtggctcgacgcccatgccgacttcaacacccacaccgtcacgcccacc
ggcaacctccacggcatgccggtggcctgcctgtgcggcaaaggcccgcaagcgctcacc
accctgggcggcccggcgccgcaactgcaaccctcctgcatccggcagatcggcatccgc
agcgtggacgcagaggaaaaacggttggtgcatcaggccgggctcgacgtgttcgacatg
cgttacatcgacgaatacggcatgcgcgacgccatgcgccgggcactcgaaggcgtggac
gccgacactcatctgcatgtgagtttcgacgtcgatttcctcgaccccgacatcgccccc
ggcgtgggcaccaccgtgcccggcggccccacctaccgcgaggcgcagctttgcatggaa
atgatcgccgacaccggcctgctggcctcgctcgacgtggtggaactcaaccccgctttc
gacgaacgcaaccgcaccgccgaggtggcggtcgatctcatcgagagcctgttcggcaag
tccacgctgatgcgcaggtga

DBGET integrated database retrieval system