KEGG   Thiomonas arsenitoxydans: THI_2679Help
Entry
THI_2679          CDS       T02347                                 

Gene name
aceF
Definition
Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THI_2679 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THI_2679 (aceF)
   00020 Citrate cycle (TCA cycle)
    THI_2679 (aceF)
   00620 Pyruvate metabolism
    THI_2679 (aceF)
Enzymes [BR:thi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     THI_2679 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2630480..2631865)
Genome map
AA seq 461 aa AA seqDB search
MAVVEVKVPDIGDFKDVEVIEVLVKAGDQIAVDQSLVTVESDKASMEIPSSAAGVVKALR
VKLGDKVSEGSVLLELDAAGAADALPAAEAPSAPVVPAAAEPAQPEASPPVALPPAAVGV
GFASEPRQHTPPTAALPVHEPAATTALLPHASPSVRKLARELGVPLAEVKGSGSKGRITA
EDVQAFVKAVMSGQTVTQAAVVAGVGAGKGAASLGGLTLLPWPKVDFAKFGPVSSQPLSR
IKKLSGPNLARNWAMIPHVTQFDEADITELEDFRKSSNERMAKQGVKLTMLAFVMKACVT
VLKQMPAFNSSLDESGENLILKDYIHLGFAADTPQGLVVPVLKDVDKKGLAQIAKEMGEL
AATAREGKLKPSDMQGATFTISSLGGVGGTAFTPIINAPEVAILGLSKSQIKPVWDGAAF
QPRLMLPLSLSYDHRVIDGAMAARFTTVLGELLADLRRVLI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgtcgaggtcaaggttcccgatatcggggacttcaaagatgtggaagtgatc
gaggttctggtgaaggccggagaccagatcgcggtcgatcaatcgctggtcacggtagag
agtgacaaggccagcatggagatccccagcagcgccgccggcgtggtgaaggcgctgcgg
gtgaagctgggcgacaaggtgagcgaaggctcggtcttgctcgaactcgacgccgcaggc
gccgccgacgcactgcccgccgcagaagctccgtccgctccggtcgttccggcagcagcc
gagcctgcgcagcccgaggcatcgccgccggtcgcgctgcctcccgcggcggttggcgtg
ggtttcgcctccgagccgcgtcagcacaccccgcccaccgccgcgttgccggtgcacgag
cctgcagcaaccactgcgctgttgccgcacgcttcgccaagtgtgcgcaagctggcgcgt
gaactcggcgtgcctctggcggaagtcaagggcagcggcagcaagggccgcatcaccgcg
gaggatgtgcaagccttcgtcaaggcggtgatgtcaggccagaccgtgactcaggccgcg
gttgtcgcgggagtcggtgcgggcaagggcgccgccagcctgggcgggctcacgctcctg
ccgtggcccaaggtggattttgccaagttcggcccggtcagcagccagccgttgtcgcgc
atcaaaaagctctcgggccccaatctggcgcgcaactgggcgatgattccgcatgtcacc
cagttcgacgaggccgacatcaccgagctggaagacttccgcaagagcagcaacgaacgc
atggccaagcaaggcgtgaagctcaccatgctcgcctttgtgatgaaagcctgcgtgacg
gtgctcaagcaaatgcccgcattcaatagttcgctcgatgaaagcggcgagaacctcatt
ctgaaggactacatccacctgggtttcgcggccgatacgccgcaaggcctggtcgtgccg
gtgctcaaggatgtggacaagaagggcctggcgcaaatcgccaaggaaatgggcgagctg
gccgcgacggcgcgcgaaggcaagctcaagccttcagacatgcagggtgcgaccttcacc
atttccagcctgggcggtgtgggcggaacggccttcacgcccatcatcaatgcgccggaa
gtggccatattggggctgtccaaatcgcagatcaaaccggtctgggacggcgccgcattc
cagccacggctgatgctgccgctgtcgctgtcgtacgaccaccgcgtcatcgacggggcg
atggccgcgcgcttcaccaccgtgctcggcgagttgctcgccgacctgcggcgtgtgctg
atctga

  All links  
No link information was found.   
DBGET integrated database retrieval system