KEGG   Thiomonas arsenitoxydans: THI_2679Help
Entry
THI_2679          CDS       T02347                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00010  Glycolysis / Gluconeogenesis
thi00020  Citrate cycle (TCA cycle)
thi00620  Pyruvate metabolism
thi01100  Metabolic pathways
thi01110  Biosynthesis of secondary metabolites
thi01120  Microbial metabolism in diverse environments
thi01130  Biosynthesis of antibiotics
thi01200  Carbon metabolism
Module
thi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THI_2679 (aceF)
   00020 Citrate cycle (TCA cycle)
    THI_2679 (aceF)
   00620 Pyruvate metabolism
    THI_2679 (aceF)
Enzymes [BR:thi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     THI_2679 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT HlyD_D23 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: CAZ89295
UniProt: D6CVH6
Position
complement(2630480..2631865)
Genome map
AA seq 461 aa AA seqDB search
MAVVEVKVPDIGDFKDVEVIEVLVKAGDQIAVDQSLVTVESDKASMEIPSSAAGVVKALR
VKLGDKVSEGSVLLELDAAGAADALPAAEAPSAPVVPAAAEPAQPEASPPVALPPAAVGV
GFASEPRQHTPPTAALPVHEPAATTALLPHASPSVRKLARELGVPLAEVKGSGSKGRITA
EDVQAFVKAVMSGQTVTQAAVVAGVGAGKGAASLGGLTLLPWPKVDFAKFGPVSSQPLSR
IKKLSGPNLARNWAMIPHVTQFDEADITELEDFRKSSNERMAKQGVKLTMLAFVMKACVT
VLKQMPAFNSSLDESGENLILKDYIHLGFAADTPQGLVVPVLKDVDKKGLAQIAKEMGEL
AATAREGKLKPSDMQGATFTISSLGGVGGTAFTPIINAPEVAILGLSKSQIKPVWDGAAF
QPRLMLPLSLSYDHRVIDGAMAARFTTVLGELLADLRRVLI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgtcgaggtcaaggttcccgatatcggggacttcaaagatgtggaagtgatc
gaggttctggtgaaggccggagaccagatcgcggtcgatcaatcgctggtcacggtagag
agtgacaaggccagcatggagatccccagcagcgccgccggcgtggtgaaggcgctgcgg
gtgaagctgggcgacaaggtgagcgaaggctcggtcttgctcgaactcgacgccgcaggc
gccgccgacgcactgcccgccgcagaagctccgtccgctccggtcgttccggcagcagcc
gagcctgcgcagcccgaggcatcgccgccggtcgcgctgcctcccgcggcggttggcgtg
ggtttcgcctccgagccgcgtcagcacaccccgcccaccgccgcgttgccggtgcacgag
cctgcagcaaccactgcgctgttgccgcacgcttcgccaagtgtgcgcaagctggcgcgt
gaactcggcgtgcctctggcggaagtcaagggcagcggcagcaagggccgcatcaccgcg
gaggatgtgcaagccttcgtcaaggcggtgatgtcaggccagaccgtgactcaggccgcg
gttgtcgcgggagtcggtgcgggcaagggcgccgccagcctgggcgggctcacgctcctg
ccgtggcccaaggtggattttgccaagttcggcccggtcagcagccagccgttgtcgcgc
atcaaaaagctctcgggccccaatctggcgcgcaactgggcgatgattccgcatgtcacc
cagttcgacgaggccgacatcaccgagctggaagacttccgcaagagcagcaacgaacgc
atggccaagcaaggcgtgaagctcaccatgctcgcctttgtgatgaaagcctgcgtgacg
gtgctcaagcaaatgcccgcattcaatagttcgctcgatgaaagcggcgagaacctcatt
ctgaaggactacatccacctgggtttcgcggccgatacgccgcaaggcctggtcgtgccg
gtgctcaaggatgtggacaagaagggcctggcgcaaatcgccaaggaaatgggcgagctg
gccgcgacggcgcgcgaaggcaagctcaagccttcagacatgcagggtgcgaccttcacc
atttccagcctgggcggtgtgggcggaacggccttcacgcccatcatcaatgcgccggaa
gtggccatattggggctgtccaaatcgcagatcaaaccggtctgggacggcgccgcattc
cagccacggctgatgctgccgctgtcgctgtcgtacgaccaccgcgtcatcgacggggcg
atggccgcgcgcttcaccaccgtgctcggcgagttgctcgccgacctgcggcgtgtgctg
atctga

DBGET integrated database retrieval system