KEGG   Thiomonas arsenitoxydans: THI_2714Help
Entry
THI_2714          CDS       T02347                                 

Definition
putative Succinate dehydrogenase hydrophobic membrane anchor protein (sdhD)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
thi  Thiomonas arsenitoxydans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THI_2714
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THI_2714
   00650 Butanoate metabolism
    THI_2714
  Energy metabolism
   00190 Oxidative phosphorylation
    THI_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2669160..2669525)
Genome map
AA seq 121 aa AA seqDB search
MAADKIGNKRLVVGAHYGLRDWMAQRVTAAVIAVFTLVLLVYFLAPGPLSFERWHDLFAQ
QWMKLLTFVTVLALIYHVWVGMRDIWMDYVKPVGVRLLLQIGTILWLLACAGWALQVLWR
A
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgacaagattggaaacaagcgcctggtcgtcggcgcgcactacggcctgcgc
gactggatggcgcagcgcgtcaccgccgccgtgatcgcggtgttcaccctggtgttgctg
gtgtattttctcgcgcccggcccgctgagcttcgagcgctggcacgatttgttcgcccag
cagtggatgaagctgctgaccttcgtgacggtgctggcgctgatctaccacgtctgggtg
ggcatgcgcgacatctggatggattacgtcaaaccggtcggcgtgcgactgctgctgcag
atcggcaccattttgtggctattggcttgcgcgggctgggccctgcaagtgttgtggaga
gcgtaa

DBGET integrated database retrieval system