KEGG   Thiomonas sp. 3As: THI_2811Help
Entry
THI_2811          CDS       T02347                                 

Definition
putative Fatty acid desaturase, type 1 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
thi  Thiomonas sp. 3As
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:thi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:thi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2755775..2756980)
Genome map
AA seq 401 aa AA seqDB search
MFDVFLNWAGHGLLRASWWQIVLFALITTHITIASVTIFLHRAQAHRALELHPIASHFFR
FWLWFTTGMVTKEWVAIHRKHHAKCETVDDPHSPVTRGIDTVLLRGAELYRTESRNAETL
SKFGHGTPDDWLERNVYSRFIWQGVGLLLILDVLMFGAIGATVWAVQMLWIPIWAAGVIN
GLGHWWGYRNFSARDRSHNISPWGLLIGGEELHNNHHTYPTSAKLSVKWWEFDIGWAYIR
ALSWVGLAKPRKLPPQFRLGEVRAEVDQLTLQAVIANRYELMARYAAGLKSTLKAELARA
AEQGAVSHLPTLRAAKRWIGIEREILCERSRALVDAAASASPNLSKLLHMREELKSVWEQ
TNLNADQLRLKLQDWCCRAEDSGLAPLRELSLRLRRYTPTA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgtgtttttgaattgggccggtcacggccttttgcgtgcatcgtggtggcaa
atcgtcttatttgcgctcatcaccacgcatatcaccattgcgtccgtcactatttttctg
caccgcgctcaggctcaccgggcgctggaactgcacccgatcgcctcgcactttttccgc
ttctggctgtggttcaccacgggcatggtcaccaaggaatgggtggcgattcatcgcaag
catcacgccaagtgcgagacggtcgacgacccgcacagtccggtgacgcgcggcatcgat
acggtgctgttgcgcggcgccgagttgtaccgaaccgaatcgagaaacgccgaaaccctg
agcaaattcggtcacggcactcctgacgactggttggagcgcaacgtttattcccgcttt
atctggcagggcgtcgggcttttgctcattctcgatgtgctgatgttcggcgcgatcggc
gccacggtgtgggccgtgcagatgttgtggattccgatctgggcagccggggtgatcaac
gggctgggtcattggtggggctatcgcaatttttcggcgcgagaccgcagccacaacatt
tcgccctgggggttgctgatcggcggcgaagagttgcacaacaaccaccacacctatccc
acgtcggccaaactctcggtcaaatggtgggagttcgatatcggctgggcgtatatccgc
gctttgtcctgggtgggtttggccaaaccacgcaaactgccgccgcagttccggctgggc
gaggtgcgcgccgaggtcgatcagctcactttgcaagccgttatcgccaaccgttatgag
ttgatggcgcgctatgccgcggggttgaagtccaccctcaaggccgagctggcccgagct
gcagaacagggcgcggtgagccatctgccgactttgcgtgcagccaaacgctggatcggc
atcgagcgcgagattctgtgcgagcgttcgcgagccttggtggacgccgcggcgagcgcc
agccctaacctgagcaagctgctgcacatgcgcgaagaactcaaatcggtgtgggagcag
accaatctgaacgccgaccagcttcgcttgaagctccaggactggtgctgccgtgccgaa
gacagtggcttggccccgcttcgggagttgtcgctgaggctgcgacgttatacgccgaca
gcctga

DBGET integrated database retrieval system