KEGG   Thiomonas arsenitoxydans: THI_2811Help
Entry
THI_2811          CDS       T02347                                 

Definition
putative Fatty acid desaturase, type 1 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    THI_2811
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    THI_2811
Enzymes [BR:thi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     THI_2811
Lipid biosynthesis proteins [BR:thi01004]
 Desaturase
  First
   THI_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2755775..2756980)
Genome map
AA seq 401 aa AA seqDB search
MFDVFLNWAGHGLLRASWWQIVLFALITTHITIASVTIFLHRAQAHRALELHPIASHFFR
FWLWFTTGMVTKEWVAIHRKHHAKCETVDDPHSPVTRGIDTVLLRGAELYRTESRNAETL
SKFGHGTPDDWLERNVYSRFIWQGVGLLLILDVLMFGAIGATVWAVQMLWIPIWAAGVIN
GLGHWWGYRNFSARDRSHNISPWGLLIGGEELHNNHHTYPTSAKLSVKWWEFDIGWAYIR
ALSWVGLAKPRKLPPQFRLGEVRAEVDQLTLQAVIANRYELMARYAAGLKSTLKAELARA
AEQGAVSHLPTLRAAKRWIGIEREILCERSRALVDAAASASPNLSKLLHMREELKSVWEQ
TNLNADQLRLKLQDWCCRAEDSGLAPLRELSLRLRRYTPTA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgtgtttttgaattgggccggtcacggccttttgcgtgcatcgtggtggcaa
atcgtcttatttgcgctcatcaccacgcatatcaccattgcgtccgtcactatttttctg
caccgcgctcaggctcaccgggcgctggaactgcacccgatcgcctcgcactttttccgc
ttctggctgtggttcaccacgggcatggtcaccaaggaatgggtggcgattcatcgcaag
catcacgccaagtgcgagacggtcgacgacccgcacagtccggtgacgcgcggcatcgat
acggtgctgttgcgcggcgccgagttgtaccgaaccgaatcgagaaacgccgaaaccctg
agcaaattcggtcacggcactcctgacgactggttggagcgcaacgtttattcccgcttt
atctggcagggcgtcgggcttttgctcattctcgatgtgctgatgttcggcgcgatcggc
gccacggtgtgggccgtgcagatgttgtggattccgatctgggcagccggggtgatcaac
gggctgggtcattggtggggctatcgcaatttttcggcgcgagaccgcagccacaacatt
tcgccctgggggttgctgatcggcggcgaagagttgcacaacaaccaccacacctatccc
acgtcggccaaactctcggtcaaatggtgggagttcgatatcggctgggcgtatatccgc
gctttgtcctgggtgggtttggccaaaccacgcaaactgccgccgcagttccggctgggc
gaggtgcgcgccgaggtcgatcagctcactttgcaagccgttatcgccaaccgttatgag
ttgatggcgcgctatgccgcggggttgaagtccaccctcaaggccgagctggcccgagct
gcagaacagggcgcggtgagccatctgccgactttgcgtgcagccaaacgctggatcggc
atcgagcgcgagattctgtgcgagcgttcgcgagccttggtggacgccgcggcgagcgcc
agccctaacctgagcaagctgctgcacatgcgcgaagaactcaaatcggtgtgggagcag
accaatctgaacgccgaccagcttcgcttgaagctccaggactggtgctgccgtgccgaa
gacagtggcttggccccgcttcgggagttgtcgctgaggctgcgacgttatacgccgaca
gcctga

DBGET integrated database retrieval system