KEGG   Thiomonas sp. 3As: THI_2948Help
Entry
THI_2948          CDS       T02347                                 

Gene name
pyrB
Definition
Aspartate carbamoyltransferase (Aspartate transcarbamylase) (ATCase) (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
thi  Thiomonas sp. 3As
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:thi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:thi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2890998..2891966
Genome map
AA seq 322 aa AA seqDB search
MTRAHNPQLNKNGELRHLLTPEGLPRDVLTHILDTAQGFVSFGSREVKKVPLLRGKSVFN
LFFENSTRTRTTFEIAAQRLSADVFNLDIQRSSTSKGESLLDTIANLEAMDADVFVVRHS
DSGAPFLIAQHTPPHVHIVNAGDGRHAHPTQGLLDMYTIRHFKGDFSNLTVAIVGDIVHS
RVARSAIHALTTLGAAEVRAVGPKTLAPDNLRDMGVRVCHDMAEGIRSADVIMMLRLQNE
RMSGALLPSAHEFNMTYGLTPGRLALAKPDVIVMHPGPINRGVEIDSSVADGPRSVILDQ
VRFGIAVRMAVLSIVASTESPA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcccacaacccccaactcaacaaaaacggcgagctgcgccacctgctcacc
cccgaaggcctgccgcgcgacgtgctcacgcacatcctcgacaccgcgcagggctttgtc
agcttcggcagccgcgaagtgaaaaaagtgccgctgctacgcggcaagagcgtgttcaac
ctgtttttcgagaacagcacccgcacccgcaccaccttcgagatcgcggcgcaacgcctg
tcggccgacgtgttcaatctcgacatccagcgctccagcacgagcaagggcgagagcctg
ctcgacaccatcgccaacctcgaagcgatggatgccgatgtatttgtcgtgcgccactcc
gacagcggcgcgccctttctcatcgcccagcacacgcccccgcatgtgcacatcgtcaac
gccggcgatggccgccatgcccaccccacccagggtctgctggacatgtacaccatccgt
catttcaagggcgacttcagcaacctcaccgtggccatcgtcggcgacatcgtgcattcg
cgcgtggcacgctcggccattcacgcgctcaccacgctgggcgctgccgaggtgcgcgcc
gtcggccccaagaccctggcgcccgacaatctgcgcgacatgggcgtgcgcgtctgccac
gacatggccgagggtattcgcagcgccgacgtcatcatgatgctgcgactgcaaaacgag
cgcatgtcgggtgcgctgctgccgtccgcgcatgaattcaacatgacctacggcctcacg
cccgggcgcctggcactggccaagcccgatgtcatcgtgatgcatcccggccccatcaat
cgcggcgtcgagatcgacagcagcgtggctgatgggccgcgcagcgtcatcctcgaccaa
gtgcgcttcggcatcgccgtgcgcatggccgtgctgtccatcgtcgcctccaccgaaagc
cccgcatga

DBGET integrated database retrieval system