KEGG   Thiomonas arsenitoxydans: THI_2966Help
Entry
THI_2966          CDS       T02347                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-L-rhamnose synthetase)
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
thi  Thiomonas arsenitoxydans
Pathway
thi00521  Streptomycin biosynthesis
thi00523  Polyketide sugar unit biosynthesis
thi01130  Biosynthesis of antibiotics
Module
thi_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    THI_2966 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    THI_2966 (rfbC)
Enzymes [BR:thi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     THI_2966 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CAZ89571
UniProt: D6CLZ3
Position
complement(2912967..2913530)
Genome map
AA seq 187 aa AA seqDB search
MKVIPTALPEVLILEPKVFGDDRGFFFESYNRKTFALDTGLDVEFVQDNHSKSAQGVLRG
LHYQLVKPQGKLVRAVTGTVWDVAVDLRRSSPRFKQWVGVELSAQNQRLLWVPPGFGHGF
VVLSETADFLYKTTDYWYPEHDRNLAWNDPELAIAWPLKGLHLPGGQPSLAAKDAAAPRL
AQAEVYD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcattcccaccgccctacccgaagtgctcattctggagcccaaagtctttggg
gacgaccgcggctttttcttcgagagctacaaccgcaagaccttcgcgttggacaccggg
ctggatgtggagttcgtgcaggacaaccattccaaatccgcccagggcgtgctgcgcggt
ctgcactaccagctcgtcaagccgcagggcaagctggtgcgcgcggtcaccggcacggtc
tgggatgtggcggtggatctgcgccgcagctcgccgcggttcaagcagtgggtgggcgtg
gaactgagcgcgcagaaccagcgcctgctgtgggtgccgccgggcttcggtcacggcttc
gtggtgctgagcgaaaccgccgacttcctctacaagaccaccgactactggtacccggaa
cacgaccgcaatctcgcctggaacgatccggaactggccatcgcctggccgctgaaaggt
ttgcacctgccgggcggccagccgagtctggcggcgaaggatgcggcggcgccccggctg
gcgcaggccgaggtgtacgactga

DBGET integrated database retrieval system