KEGG   Thiomonas arsenitoxydans: THI_2966Help
Entry
THI_2966          CDS       T02347                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-L-rhamnose synthetase) (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    THI_2966 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    THI_2966 (rfbC)
Enzymes [BR:thi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     THI_2966 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2912967..2913530)
Genome map
AA seq 187 aa AA seqDB search
MKVIPTALPEVLILEPKVFGDDRGFFFESYNRKTFALDTGLDVEFVQDNHSKSAQGVLRG
LHYQLVKPQGKLVRAVTGTVWDVAVDLRRSSPRFKQWVGVELSAQNQRLLWVPPGFGHGF
VVLSETADFLYKTTDYWYPEHDRNLAWNDPELAIAWPLKGLHLPGGQPSLAAKDAAAPRL
AQAEVYD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcattcccaccgccctacccgaagtgctcattctggagcccaaagtctttggg
gacgaccgcggctttttcttcgagagctacaaccgcaagaccttcgcgttggacaccggg
ctggatgtggagttcgtgcaggacaaccattccaaatccgcccagggcgtgctgcgcggt
ctgcactaccagctcgtcaagccgcagggcaagctggtgcgcgcggtcaccggcacggtc
tgggatgtggcggtggatctgcgccgcagctcgccgcggttcaagcagtgggtgggcgtg
gaactgagcgcgcagaaccagcgcctgctgtgggtgccgccgggcttcggtcacggcttc
gtggtgctgagcgaaaccgccgacttcctctacaagaccaccgactactggtacccggaa
cacgaccgcaatctcgcctggaacgatccggaactggccatcgcctggccgctgaaaggt
ttgcacctgccgggcggccagccgagtctggcggcgaaggatgcggcggcgccccggctg
gcgcaggccgaggtgtacgactga

DBGET integrated database retrieval system