KEGG   Thiomonas sp. 3As: THI_2966Help
Entry
THI_2966          CDS       T02347                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-L-rhamnose synthetase) (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
thi  Thiomonas sp. 3As
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:thi00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:thi00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2912967..2913530)
Genome map
AA seq 187 aa AA seqDB search
MKVIPTALPEVLILEPKVFGDDRGFFFESYNRKTFALDTGLDVEFVQDNHSKSAQGVLRG
LHYQLVKPQGKLVRAVTGTVWDVAVDLRRSSPRFKQWVGVELSAQNQRLLWVPPGFGHGF
VVLSETADFLYKTTDYWYPEHDRNLAWNDPELAIAWPLKGLHLPGGQPSLAAKDAAAPRL
AQAEVYD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcattcccaccgccctacccgaagtgctcattctggagcccaaagtctttggg
gacgaccgcggctttttcttcgagagctacaaccgcaagaccttcgcgttggacaccggg
ctggatgtggagttcgtgcaggacaaccattccaaatccgcccagggcgtgctgcgcggt
ctgcactaccagctcgtcaagccgcagggcaagctggtgcgcgcggtcaccggcacggtc
tgggatgtggcggtggatctgcgccgcagctcgccgcggttcaagcagtgggtgggcgtg
gaactgagcgcgcagaaccagcgcctgctgtgggtgccgccgggcttcggtcacggcttc
gtggtgctgagcgaaaccgccgacttcctctacaagaccaccgactactggtacccggaa
cacgaccgcaatctcgcctggaacgatccggaactggccatcgcctggccgctgaaaggt
ttgcacctgccgggcggccagccgagtctggcggcgaaggatgcggcggcgccccggctg
gcgcaggccgaggtgtacgactga

DBGET integrated database retrieval system