KEGG   Thiomonas sp. 3As: THI_2980Help
Entry
THI_2980          CDS       T02347                                 

Definition
putative DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
thi  Thiomonas sp. 3As
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:thi00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:thi00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:thi03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:thi03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:thi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2926530..2926985)
Genome map
AA seq 151 aa AA seqDB search
MSGNPPLRAIMPCSVEFRVNLPDPLRYACGLLRTATQRGARVLVAAPEPLLTELDPLLWT
FQPGSFVPHVWQDDPLADKTPVILAPQPDLPRAGRVTALVNLGPDLVTGWESLERVIELV
SENGPDKPAARERLRAYRAAGFDPTIIPSRS
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgtccggcaacccgccgttgcgcgccatcatgccctgctcagtcgagtttcgtgtgaac
ctgcctgacccgctgcgttacgcctgtgggctgctgcgcacggcgacacagcgcggcgct
cgcgtgctggtagccgcgcccgagcccttgctcacggaactcgatccgttgttgtggact
tttcagcccggcagttttgtgccgcatgtctggcaggacgacccgctcgctgacaaaacg
ccggtcatcctggctcctcagcccgatctgccccgggccgggcgggtgactgccctggtg
aatctcggccccgatctggtgaccggctgggaatctctggagcgagtgatcgaactcgtc
agtgaaaacgggcccgacaagcccgccgcccgcgaacgcctgcgcgcttatcgggccgcc
gggttcgatcccaccatcatcccgtcccgatcatga

DBGET integrated database retrieval system