KEGG   Thiomonas arsenitoxydans: THI_3043Help
Entry
THI_3043          CDS       T02347                                 

Definition
putative nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    THI_3043
Enzymes [BR:thi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     THI_3043
    3.5.1.-  
     THI_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2980403..2981020)
Genome map
AA seq 205 aa AA seqDB search
MKSAPVLLVIDVQNGFCTGGGLPVPDGEAVVPVINRLAAKFSQVVLTQDWHPPGHASFAS
AHPGRQPFETITLPYGPQVLWPDHCIQGTRDAALHPDLHIAHAQAVIRKGWRAGIDSYSV
FMEADRSTPTGLTGYLRELDVRELVLCGLATDFCVAWSALDARAAGFEVTVVEDACRAID
LNGSLDQAWAQMRAAGVRRAMSTAF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgctcccgtgctgctggtgatcgacgtgcagaacggtttttgcaccggaggc
ggcctgccggtgccggatggcgaagccgtggtgccggtgatcaaccggctggcggccaag
ttttcgcaggtggtgttgacgcaggactggcacccgccgggccatgcgtccttcgctagc
gcgcatccggggcggcagcctttcgagaccatcactttgccctacggcccgcaggtgctg
tggccggaccattgcattcagggtacacgcgacgcggcccttcaccccgatctgcacatt
gcgcacgctcaggcagtcattcgcaaaggctggcgggcgggcatcgacagttactcggtc
ttcatggaagccgaccgcagcacgcccaccggcttgacgggctatctgcgcgaactggac
gtgcgcgaactggtgttgtgcggattggccacggatttctgcgtagcctggagcgccttg
gacgcccgagctgcaggttttgaggtgaccgtggtggaagacgcctgccgcgccatcgat
ctcaacggctcgctggatcaggcctgggcgcagatgcgcgccgccggggtgcggcgcgca
atgtccaccgcgttctga

DBGET integrated database retrieval system