KEGG   Thiomonas sp. 3As: THI_3184Help
Entry
THI_3184          CDS       T02347                                 

Definition
putative Asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
thi  Thiomonas sp. 3As
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:thi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3098093..3099895)
Genome map
AA seq 600 aa AA seqDB search
MCGIYGFFDRTGGELSEQTLAAMDASLVHRGPDDSGAFSAAGVTIGNRRLSIIDLAGGHQ
PFVSDDGRIALVQNGEIFNHVELRAEAQRRGVRFHSDHSDTEVLLRLYEREGLGFLPRLN
GMFAIAIWDGRDPENPRLHLVRDRIGVKPLFMHDDGRQVLFGSEIKAVLAALPGRPALDL
PALQHYLAYNYVPPPFTLFAGVRHVLPGTVLTVDGAGSHACRWWSLAEQTPIAQTFTTWQ
EEFLDLLDDAVRLRLRADVSFGAFLSGGVDSSTVVALMARHVREPARTFCIGFPDPRFDE
SPYAREAAQRFGATHRERIVQPDMLDDWARVLWHCDQPHGDASFMPTRSVSQLAVQDVKV
VLTGDGGDELFAGYDKYASFMAAPALRDLPATDFAQHYVEHTGLFGAQARAALFQPWLRT
KLADVDSVRDVAAPWFEQAAHFDRVNQMLFLDMMLLLPGNNLVKPDRMGMSVSLEARTPL
LDWRLMEFAFRAPGDTKLKDGDKKHWFKRAVEPLIGADLAHRKKQMFTVPIGEWFRGPRK
AWLAELLFAPNALGAQLFEADAVRKLFDDHVSGAANHTRELRALAALELWAQQFEPEISA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatttatggatttttcgaccgtaccggcggcgagctgagcgagcaaaccctc
gccgcgatggacgccagcctcgtccatcgcggcccggatgacagcggcgcatttagcgct
gcgggcgtgacgattggcaaccgaaggctctccatcatcgacctcgccggtggtcaccag
cccttcgtcagcgacgacgggcgaatcgccctggtgcaaaacggcgagattttcaaccat
gtggaactgcgcgctgaggcgcagcgccggggcgtgcgcttccactccgatcacagcgat
accgaagtgctgctgcggttgtatgaacgcgaagggctgggcttcctgccgcggctcaac
ggcatgttcgccatcgctatctgggatgggcgcgatccagaaaatccccggctgcatctg
gtgcgcgaccgcatcggcgtcaagccgctgttcatgcacgacgacggcaggcaggtactg
ttcggctccgagatcaaggccgtgctcgccgcgctgccaggccgtcccgcgctcgatctg
cccgcgctgcagcactaccttgcctacaactacgttccgccgcccttcaccctgttcgcg
ggcgtgcgccacgtcctgcccggcacggtgctcactgtcgatggcgccggcagccacgcc
tgccgctggtggagcctggcggagcagacgccgatcgctcagaccttcaccacctggcag
gaagagtttctcgacctgctcgacgacgcggtgcgcctgcgactgcgcgccgacgtgtcc
ttcggcgcctttctctcgggcggggtcgattccagcaccgtcgtggcgctcatggcgcgg
catgtgcgcgaacctgcgcgcactttttgcatcggctttcccgatccgcgcttcgacgaa
tcgccctacgcccgcgaggctgcgcagcgcttcggcgccacgcaccgcgagcgcatcgtg
cagcccgacatgctcgacgactgggcccgcgtgctgtggcactgcgaccagccgcacggc
gacgcctcgttcatgcccacgcgcagcgtcagccaactcgccgttcaggatgtgaaagtc
gtgctcaccggcgacggcggcgacgagctgttcgccggctacgacaaatacgccagcttc
atggccgcccccgcgctgcgcgacctgcccgcgaccgacttcgcccagcactatgtggag
cacaccggcctgttcggcgcgcaggcccgcgccgcgctgttccagccctggctgcgcacc
aagctggccgatgtggacagcgtgcgcgacgtggccgcgccctggttcgagcaggccgcg
cacttcgaccgcgtcaaccagatgctgtttctggacatgatgttgctgctgcccggcaac
aacctggtgaagcccgaccgcatgggtatgtcggtgtcgctggaggcgcgcacgcccttg
ctcgattggcgcctgatggagttcgccttccgcgcgcccggcgacaccaagctgaaggac
ggcgacaaaaagcactggttcaagcgcgcggtcgagcccctcatcggcgccgacctcgcg
caccgcaaaaagcagatgttcaccgttcccatcggcgagtggtttcgcgggccgcgcaag
gcctggctggccgaattgctgttcgcaccgaacgcgctcggcgcccagctgttcgaggcc
gacgcggtacgcaagctgttcgacgaccatgtctcgggcgcggcgaaccacacccgcgaa
ctgcgcgccctggcggcgctggagctctgggcgcagcaattcgagcccgagatttccgca
tga

DBGET integrated database retrieval system