KEGG   Thiomonas arsenitoxydans: THI_3191Help
Entry
THI_3191          CDS       T02347                                 

Definition
putative exodeoxyribonuclease V, alpha subunit recD (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
thi  Thiomonas arsenitoxydans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:thi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    THI_3191
Enzymes [BR:thi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     THI_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3111842..3113917
Genome map
AA seq 691 aa AA seqDB search
MRPAPTNAPNAPTQRVLDVLHDWAEQGVLRRLDAALARFLAELCPQMPPELAVAVALLAD
LEGRGHTCVLLGELPQHFIALKERAATAGAPALSPDVHWPNDGERLLRECPAVYCEGEPD
HGAPLIFSRERRAAPSSLDPLGGRGGRSTTLGAMEAERLYLRRYWRDENTVAARIHQRLQ
PEATVDAPAAAALLARLFPPADDTEVDWQKLACALALRGRFTLLTGGPGTGKTHTAARLL
ALLWALRSQPGALRVALAAPTGKAAARLKQSIDRELVKLAALPGVAELSQRLGPARTLHS
LLGARPDTRRFARNAAQPLEVDVLLVDEASMIHLEMMAALLDALPPTARLILLGDKDQLA
SVEAGAVLGELCTGAQQGRYTPQTAQALQALCGDRIPQPFIDPTGPALLQRVVMLRKSHR
FGGAIGQLAQAVNAGDAERAQALLQQTDGAAVRLLPVPQLLAPVFSPVSAPVAAPALVDL
AVQGRDGAKGYAHYADLLRQGPTAEADWDAWAQRVLQAFDQCRVLCAVREGPWGVQALNE
AIAARLDALGLLHGRGAWYAGRPVMVTRNDHDLGVLNGDVGIALPTGTQGLRGVFLQGQS
LRSVSISRLADVQTAFAMTVHQSQGSEFDHTVLVLPERHAGLSRELIYTGITRARRFFTL
ACADMQTLHEGIQRVTQRASGLLSRIDKLPA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccgccccgaccaacgcgccgaatgcgccgacccagcgcgttctcgacgtgctg
cacgactgggcagagcaaggcgtgctgcggcggctggacgctgcgctggcccgcttcctg
gctgaactctgcccgcaaatgccgccagaactggcggtagccgtggcgctgctcgccgat
ctggaggggcgcggtcatacctgcgtgctgctgggcgaattgccgcaacacttcatcgcc
ttgaaagagcgcgccgccacggcgggcgcgcctgccctgtcgcccgatgtgcactggccc
aacgacggcgagcgcctgctgcgcgagtgcccggccgtttactgcgagggcgagccggac
cacggcgcgccgctgatattctcaagggaacgcagggccgccccaagttcccttgacccc
ctcggggggcggggcgggcgtagcacgaccctgggggcgatggaggcagagcggctgtat
ctgcgccgctactggcgagatgagaacaccgtggccgcacggattcaccagcgcctgcag
cctgaagccacggtcgatgcacccgctgctgcagcgctgctggcacggcttttcccgcct
gccgacgatacggaagtggactggcagaaactggcgtgcgcgctggcgctacgcggacgt
ttcaccctgctcaccggcggtcccggtaccggcaaaacacatactgcggcgcggctgctg
gctttgctgtgggctttgagatcccaacccggcgcgctgcgcgtggcgctggcggccccc
acgggcaaggccgcagcccggctcaagcagtccatcgaccgcgagctcgtcaagctcgcc
gccctccccggcgtggccgaactgtcgcagcgcctcggccctgcacgcaccctgcacagc
ctgctcggcgcgcggcccgatacccgccgcttcgcccgcaacgccgcgcagcccttggag
gtggatgtgctgctggtcgatgaggcgtccatgattcatctggaaatgatggccgcgctg
ctcgacgccttgccgcccacggcacggctcattttgctgggcgacaaggatcagctcgct
tcggtggaagccggtgcggtgctcggcgagctgtgcaccggggcgcagcagggccgctac
acgccgcaaacggcgcaggcgctgcaggctctgtgcggcgaccgtattcctcagcccttc
atcgaccccaccggccccgcgctgttgcagcgggtggtgatgttgcgcaaaagtcatcgc
ttcggcggcgccatcgggcaactggcccaggcggtgaacgcgggcgacgccgagcgggcg
caggcgctgctgcagcagaccgacggtgcggcggtgcggctgttgcccgtaccccagttg
ctggcgcccgttttctccccggtttcagcccctgttgcagccccggcgctggtcgatctt
gcggtgcagggtcgtgatggcgccaagggctatgcccactacgccgatttgctgcggcag
gggccgacggctgaggcagattgggacgcctgggcgcagcgcgtgctgcaagctttcgat
cagtgccgcgtgctgtgcgcggtgcgcgaagggccttggggcgtgcaggcgctgaacgag
gccatcgccgcgcggctggacgcgctcggcctgctgcacggtcgcggcgcgtggtacgcg
ggtcgcccggtgatggtcacgcgcaacgatcacgatctgggcgtgctcaacggcgatgtc
ggcatcgccttgccgaccggcacgcagggcttgcggggggtgtttctgcaggggcagagc
ctgcgctcggtcagcatcagccgtctggccgatgtgcagacggcgttcgccatgacggtg
caccagtcgcaggggtcggagttcgatcacaccgtgctggtgctgcccgagcgccacgcc
gggctcagccgcgagctgatctacaccggcatcacgcgcgcgcgccgctttttcaccctg
gcctgcgcagacatgcagacgctgcatgagggcatccagcgcgtcacgcaacgggccagc
ggattgctctcgcgcatcgataaactgcctgcatga

DBGET integrated database retrieval system